CYSQ - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CYSQ - 3'(2'),5'-bisphosphate nucleotidase CysQ

UniProt:	P22255	Sequences: MLDQVCQLARNAGDAIMQVYDGTKPMDVVSKADNSPVTAADIAAHTVIMDGLRTLTPDVPVLSEEDPPGWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIDHGKPILGVVYAPVMNVMYSAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHADAELKEYLQQLGEHQTTSIGSSLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVHDWQGKPLDYTPRESFLNPGFRVSIY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10043
Length:	246 (222)
Sequences:	10117 (7212)
Seq/√Len:	484.1

ECOLI - CYSQ SUHB
BACSU - SUHB
HALSA - Q9HQ12
SULSO - Q97W26

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
213_A	218_A	4.118	1.00
116_Y	123_M	3.450	1.00
78_R	106_D	3.279	1.00
127_A	130_K	3.178	1.00
77_Q	107_H	3.025	1.00
210_H	214_A	2.884	1.00
117_A	120_M	2.697	1.00
8_L	51_G	2.681	1.00
11_N	51_G	2.573	1.00
29_V	42_I	2.365	1.00
15_A	47_V	2.357	1.00
13_G	116_Y	2.214	1.00
79_Y	105_I	2.181	1.00
78_R	104_L	2.170	1.00
125_S	132_W	2.167	1.00
109_K	128_E	2.110	1.00
98_F	119_V	2.102	1.00
222_D	226_K	2.090	1.00
39_A	43_A	2.047	1.00
45_H	63_S	1.970	1.00
19_V	40_A	1.938	1.00
56_T	59_V	1.915	1.00
16_I	44_A	1.907	1.00
46_T	50_D	1.905	1.00
51_G	54_T	1.867	1.00
106_D	111_I	1.864	1.00
81_L	105_I	1.851	1.00
152_V	192_A	1.818	1.00
105_I	110_P	1.794	1.00
59_V	78_R	1.789	1.00
49_M	53_R	1.779	1.00
113_G	211_A	1.777	1.00
133_K	189_E	1.762	1.00
211_A	215_A	1.729	1.00
47_V	51_G	1.684	1.00
122_V	133_K	1.680	1.00
124_Y	189_E	1.664	1.00
126_A	215_A	1.658	1.00
49_M	61_V	1.652	1.00
9_A	102_I	1.634	1.00
17_M	119_V	1.632	1.00
99_T	181_S	1.624	1.00
115_V	185_C	1.603	1.00
6_C	125_S	1.576	1.00
117_A	182_L	1.562	1.00
5_V	80_W	1.544	1.00
4_Q	56_T	1.506	1.00
132_W	137_G	1.495	1.00
4_Q	8_L	1.474	1.00
103_A	207_A	1.470	1.00
128_E	215_A	1.468	1.00
185_C	212_V	1.459	1.00
4_Q	55_L	1.453	1.00
146_D	149_P	1.444	1.00
15_A	18_Q	1.439	1.00
101_N	181_S	1.426	1.00
9_A	114_V	1.425	1.00
77_Q	106_D	1.423	1.00
129_G	215_A	1.415	1.00
59_V	80_W	1.414	1.00
20_Y	98_F	1.408	1.00
122_V	191_Q	1.406	1.00
122_V	189_E	1.401	1.00
38_T	92_I	1.364	1.00
7_Q	55_L	1.360	1.00
50_D	54_T	1.358	1.00
82_V	102_I	1.349	1.00
164_K	168_Q	1.349	1.00
51_G	55_L	1.327	1.00
6_C	10_R	1.309	1.00
10_R	123_M	1.309	1.00
48_I	82_V	1.306	1.00
80_W	104_L	1.302	1.00
109_K	214_A	1.287	1.00
16_I	85_L	1.284	1.00
46_T	66_D	1.284	1.00
128_E	214_A	1.273	1.00
36_P	92_I	1.271	1.00
36_P	89_K	1.257	1.00
184_F	209_G	1.247	1.00
7_Q	11_N	1.239	1.00
6_C	123_M	1.238	1.00
16_I	98_F	1.227	1.00
17_M	98_F	1.219	1.00
43_A	46_T	1.211	1.00
95_N	178_I	1.204	1.00
186_L	191_Q	1.199	1.00
45_H	66_D	1.189	1.00
11_N	47_V	1.188	1.00
131_A	138_V	1.186	1.00
48_I	102_I	1.185	1.00
210_H	220_V	1.183	1.00
111_I	128_E	1.174	1.00
138_V	142_I	1.171	1.00
145_R	148_R	1.171	1.00
165_E	169_Q	1.168	1.00
52_L	59_V	1.145	1.00
49_M	63_S	1.131	1.00
45_H	49_M	1.131	1.00
62_L	81_L	1.121	1.00
126_A	211_A	1.115	1.00
214_A	227_P	1.113	1.00
81_L	207_A	1.094	1.00
15_A	43_A	1.090	1.00
116_Y	121_N	1.067	1.00
18_Q	22_G	1.064	1.00
42_I	46_T	1.061	1.00
14_D	18_Q	1.059	1.00
166_Y	169_Q	1.053	1.00
166_Y	170_L	1.050	1.00
16_I	40_A	1.048	1.00
49_M	66_D	1.034	1.00
7_Q	51_G	1.033	1.00
8_L	48_I	1.032	1.00
73_R	76_W	1.005	1.00
104_L	112_L	1.004	1.00
103_A	110_P	0.999	1.00
110_P	211_A	0.993	1.00
19_V	43_A	0.987	1.00
182_L	186_L	0.982	1.00
62_L	79_Y	0.980	1.00
131_A	215_A	0.977	1.00
20_Y	119_V	0.977	1.00
8_L	47_V	0.969	1.00
19_V	39_A	0.959	1.00
15_A	19_V	0.955	1.00
11_N	14_D	0.947	1.00
97_E	186_L	0.936	1.00
131_A	212_V	0.933	1.00
110_P	210_H	0.927	1.00
32_A	35_S	0.927	1.00
184_F	213_A	0.923	1.00
201_T	206_T	0.920	1.00
165_E	168_Q	0.911	1.00
151_L	194_L	0.909	1.00
31_K	38_T	0.902	1.00
78_R	111_I	0.896	1.00
115_V	212_V	0.893	1.00
137_G	142_I	0.892	1.00
41_D	65_E	0.886	1.00
27_D	39_A	0.878	1.00
152_V	155_S	0.871	1.00
101_N	115_V	0.868	1.00
112_L	127_A	0.861	1.00
90_E	176_T	0.860	1.00
44_A	48_I	0.858	1.00
44_A	85_L	0.855	1.00
38_T	88_T	0.854	1.00
10_R	121_N	0.848	1.00
104_L	111_I	0.847	1.00
4_Q	52_L	0.847	1.00
20_Y	94_R	0.844	1.00
163_L	166_Y	0.839	1.00
154_I	157_S	0.838	1.00
65_E	88_T	0.838	1.00
124_Y	185_C	0.833	1.00
63_S	66_D	0.831	1.00
64_E	88_T	0.829	1.00
60_P	79_Y	0.817	1.00
155_S	158_H	0.813	1.00
101_N	208_A	0.811	1.00
103_A	211_A	0.804	1.00
52_L	56_T	0.792	1.00
31_K	37_V	0.790	1.00
115_V	209_G	0.786	1.00
141_Q	144_V	0.784	1.00
10_R	116_Y	0.782	1.00
105_I	207_A	0.780	1.00
15_A	44_A	0.777	1.00
109_K	227_P	0.776	1.00
128_E	211_A	0.774	1.00
17_M	121_N	0.772	1.00
6_C	114_V	0.771	1.00
45_H	67_P	0.769	1.00
56_T	80_W	0.762	1.00
134_E	138_V	0.762	1.00
5_V	114_V	0.757	1.00
10_R	14_D	0.755	1.00
62_L	204_W	0.755	1.00
127_A	215_A	0.753	1.00
26_M	39_A	0.749	1.00
143_Q	149_P	0.747	1.00
161_A	165_E	0.744	1.00
135_E	138_V	0.734	1.00
47_V	50_D	0.728	1.00
44_A	100_V	0.728	1.00
187_V	192_A	0.726	1.00
141_Q	193_Q	0.724	1.00
41_D	88_T	0.724	1.00
138_V	189_E	0.723	1.00
184_F	220_V	0.723	1.00
19_V	22_G	0.722	1.00
222_D	225_G	0.720	1.00
52_L	104_L	0.720	1.00
139_R	142_I	0.720	1.00
101_N	209_G	0.720	1.00
12_A	44_A	0.719	1.00
122_V	134_E	0.719	1.00
40_A	44_A	0.716	1.00
134_E	137_G	0.711	1.00
39_A	42_I	0.709	1.00
5_V	112_L	0.708	1.00
149_P	193_Q	0.706	1.00
213_A	220_V	0.704	1.00
163_L	167_L	0.703	1.00
214_A	219_H	0.696	1.00
163_L	170_L	0.693	1.00
209_G	212_V	0.692	1.00
40_A	91_F	0.691	1.00
188_A	212_V	0.684	1.00
117_A	124_Y	0.684	1.00
103_A	113_G	0.683	1.00
10_R	13_G	0.682	1.00
7_Q	10_R	0.682	1.00
99_T	117_A	0.680	1.00
5_V	59_V	0.679	1.00
126_A	212_V	0.678	1.00
93_K	173_H	0.678	1.00
12_A	47_V	0.677	1.00
52_L	80_W	0.675	1.00
156_R	159_A	0.671	1.00
176_T	179_G	0.668	1.00
206_T	228_L	0.665	1.00
147_A	150_P	0.664	1.00
12_A	100_V	0.664	1.00
43_A	47_V	0.664	1.00
99_T	182_L	0.662	1.00
8_L	12_A	0.660	1.00
49_M	67_P	0.657	1.00
16_I	91_F	0.655	1.00
106_D	109_K	0.655	1.00
151_L	154_I	0.652	1.00
65_E	83_D	0.652	1.00
126_A	131_A	0.651	1.00
151_L	156_R	0.649	1.00
154_I	158_H	0.648	1.00
151_L	155_S	0.646	1.00
83_D	88_T	0.645	1.00
41_D	64_E	0.643	1.00
9_A	100_V	0.639	1.00
53_R	69_G	0.634	1.00
125_S	135_E	0.629	1.00
105_I	203_I	0.628	1.00
69_G	73_R	0.626	1.00
15_A	40_A	0.626	1.00
117_A	122_V	0.624	1.00
152_V	157_S	0.623	1.00
177_S	180_S	0.623	1.00
62_L	68_P	0.621	1.00
141_Q	146_D	0.621	1.00
41_D	83_D	0.621	1.00
22_G	25_P	0.619	0.99
162_E	165_E	0.610	0.99
197_R	201_T	0.608	0.99
18_Q	21_D	0.605	0.99
89_K	93_K	0.605	0.99
102_I	114_V	0.601	0.99
97_E	182_L	0.601	0.99
206_T	210_H	0.600	0.99
64_E	83_D	0.599	0.99
203_I	231_T	0.598	0.99
28_V	92_I	0.594	0.99
114_V	123_M	0.593	0.99
142_I	146_D	0.592	0.99
130_K	215_A	0.591	0.99
97_E	178_I	0.590	0.99
99_T	180_S	0.589	0.99
210_H	230_Y	0.586	0.99
60_P	76_W	0.586	0.99
163_L	169_Q	0.584	0.99
122_V	186_L	0.584	0.99
19_V	85_L	0.584	0.99
115_V	208_A	0.582	0.99
180_S	183_K	0.579	0.99
153_V	156_R	0.578	0.99
174_Q	177_S	0.575	0.99
13_G	17_M	0.573	0.99
64_E	84_P	0.573	0.99
132_W	215_A	0.573	0.99
12_A	16_I	0.571	0.99
158_H	161_A	0.568	0.99
73_R	231_T	0.566	0.99
64_E	205_D	0.564	0.99
14_D	17_M	0.559	0.99
86_D	205_D	0.557	0.99
30_S	33_D	0.556	0.99
131_A	216_A	0.555	0.99
221_H	225_G	0.555	0.99
143_Q	148_R	0.555	0.99
81_L	103_A	0.555	0.99
8_L	55_L	0.555	0.99
105_I	108_G	0.554	0.99
61_V	82_V	0.548	0.99
183_K	195_Y	0.548	0.99
133_K	191_Q	0.547	0.99
19_V	91_F	0.546	0.99
195_Y	201_T	0.545	0.99
52_L	55_L	0.545	0.99
9_A	116_Y	0.545	0.99
99_T	115_V	0.544	0.99
44_A	47_V	0.544	0.99
214_A	220_V	0.544	0.99
151_L	157_S	0.544	0.99
65_E	205_D	0.543	0.99
42_I	66_D	0.543	0.99
184_F	187_V	0.542	0.99
97_E	120_M	0.541	0.99
164_K	169_Q	0.538	0.99
41_D	205_D	0.533	0.98
133_K	136_C	0.532	0.98
213_A	216_A	0.531	0.98
177_S	183_K	0.530	0.98
187_V	195_Y	0.529	0.98
16_I	100_V	0.528	0.98
142_I	145_R	0.527	0.98
80_W	112_L	0.526	0.98
4_Q	51_G	0.519	0.98
152_V	158_H	0.519	0.98
6_C	135_E	0.519	0.98
31_K	35_S	0.517	0.98
79_Y	108_G	0.517	0.98
110_P	207_A	0.515	0.98
219_H	227_P	0.514	0.98
48_I	51_G	0.514	0.98
81_L	110_P	0.514	0.98
84_P	88_T	0.513	0.98
22_G	39_A	0.508	0.98
183_K	192_A	0.508	0.98
135_E	140_K	0.508	0.98
8_L	11_N	0.507	0.98
29_V	39_A	0.503	0.98
20_Y	96_G	0.500	0.98
28_V	31_K	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4n81A	2	0.9593	100	0.13	Contact Map
3lv0A	2	0.9797	100	0.142	Contact Map
2pcrA	3	0.8902	100	0.145	Contact Map
2fvzA	2	0.9187	100	0.147	Contact Map
3t0jA	3	0.9634	100	0.147	Contact Map
2qflA	1	0.9878	100	0.148	Contact Map
2p3nA	4	0.9553	100	0.151	Contact Map
3b8bA	1	0.9593	100	0.154	Contact Map
4i3yA	2	0.9675	100	0.16	Contact Map
4o7iA	1	0.9919	100	0.161	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0089 seconds.