MRAZ - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MRAZ - Transcriptional regulator MraZ

UniProt:	P22186	Sequences: MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIYHPCLLLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELWDETTWHQQVKEDIDAEQLATGDLSERLQDLSL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11084
Length:	152 (133)
Sequences:	2444 (1655)
Seq/√Len:	143.5

ECOLI - MRAZ
BACSU - MRAZ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
107_E	122_E	4.190	1.00
103_G	124_T	3.505	1.00
52_E	55_I	3.139	1.00
36_C	45_L	3.102	1.00
109_M	122_E	3.028	1.00
14_G	99_R	2.562	1.00
122_E	126_H	2.545	1.00
16_L	110_L	2.530	1.00
47_L	119_L	2.489	1.00
36_C	94_I	2.307	1.00
47_L	117_F	2.226	1.00
43_P	124_T	2.125	1.00
105_T	121_D	2.057	1.00
7_L	109_M	2.035	1.00
75_R	118_E	2.014	1.00
124_T	127_Q	1.915	1.00
3_R	57_E	1.912	1.00
35_V	50_L	1.852	1.00
9_N	107_E	1.844	1.00
42_H	71_R	1.810	1.00
96_P	100_Q	1.746	1.00
123_T	127_Q	1.735	1.00
2_F	117_F	1.730	1.00
121_D	124_T	1.672	1.00
82_S	95_A	1.581	1.00
33_Q	83_E	1.550	1.00
50_L	54_E	1.527	1.00
78_L	114_F	1.468	1.00
16_L	108_V	1.455	1.00
55_I	58_Q	1.435	1.00
3_R	83_E	1.430	1.00
64_S	70_E	1.382	1.00
65_S	74_Q	1.382	1.00
49_P	52_E	1.367	1.00
84_C	92_L	1.355	1.00
104_L	121_D	1.345	1.00
48_Y	56_I	1.331	1.00
7_L	122_E	1.322	1.00
126_H	130_K	1.312	1.00
33_Q	50_L	1.304	1.00
3_R	35_V	1.304	1.00
54_E	58_Q	1.292	1.00
127_Q	131_E	1.291	1.00
79_G	125_W	1.286	1.00
46_L	116_K	1.285	1.00
43_P	101_H	1.277	1.00
52_E	115_N	1.264	1.00
22_Y	117_F	1.259	1.00
61_S	114_F	1.250	1.00
10_L	104_L	1.227	1.00
2_F	22_Y	1.202	1.00
21_R	83_E	1.199	1.00
35_V	81_A	1.193	1.00
68_P	72_R	1.192	1.00
99_R	104_L	1.191	1.00
9_N	106_K	1.171	1.00
38_I	80_H	1.160	1.00
123_T	126_H	1.153	0.99
135_A	138_L	1.153	0.99
58_Q	62_R	1.138	0.99
48_Y	53_W	1.132	0.99
55_I	59_K	1.128	0.99
46_L	77_L	1.118	0.99
127_Q	130_K	1.114	0.99
5_A	80_H	1.103	0.99
51_P	54_E	1.076	0.99
84_C	95_A	1.076	0.99
6_T	22_Y	1.048	0.99
57_E	114_F	1.045	0.99
96_P	99_R	1.039	0.99
18_V	92_L	1.004	0.99
82_S	97_V	1.003	0.99
17_S	89_A	0.992	0.98
39_D	46_L	0.968	0.98
69_V	72_R	0.962	0.98
12_S	88_G	0.954	0.98
110_L	117_F	0.948	0.98
36_C	84_C	0.931	0.98
58_Q	61_S	0.914	0.97
131_E	134_D	0.909	0.97
94_I	119_L	0.905	0.97
111_V	125_W	0.877	0.97
2_F	49_P	0.877	0.97
44_C	118_E	0.858	0.96
10_L	108_V	0.845	0.96
43_P	115_N	0.845	0.96
14_G	104_L	0.841	0.96
36_C	47_L	0.834	0.96
75_R	113_Q	0.822	0.95
103_G	121_D	0.817	0.95
8_V	110_L	0.816	0.95
18_V	110_L	0.812	0.95
54_E	57_E	0.811	0.95
4_G	81_A	0.810	0.95
8_V	20_T	0.807	0.95
61_S	115_N	0.805	0.95
44_C	120_W	0.801	0.94
11_D	15_R	0.801	0.94
27_L	33_Q	0.793	0.94
33_Q	85_Q	0.791	0.94
63_L	70_E	0.785	0.94
28_E	51_P	0.756	0.93
76_L	129_V	0.746	0.92
12_S	105_T	0.743	0.92
34_M	47_L	0.735	0.92
50_L	83_E	0.725	0.91
37_T	81_A	0.714	0.90
8_V	17_S	0.702	0.90
46_L	113_Q	0.700	0.89
17_S	23_R	0.699	0.89
2_F	25_Q	0.696	0.89
21_R	82_S	0.694	0.89
128_Q	131_E	0.692	0.89
72_R	128_Q	0.690	0.89
100_Q	103_G	0.690	0.89
39_D	71_R	0.675	0.88
5_A	38_I	0.674	0.88
119_L	126_H	0.673	0.88
67_N	70_E	0.672	0.87
53_W	75_R	0.669	0.87
73_V	77_L	0.668	0.87
26_L	34_M	0.665	0.87
17_S	20_T	0.663	0.87
60_L	74_Q	0.659	0.86
75_R	120_W	0.659	0.86
57_E	60_L	0.658	0.86
56_I	77_L	0.656	0.86
106_K	121_D	0.651	0.86
35_V	83_E	0.650	0.86
24_E	27_L	0.649	0.86
4_G	37_T	0.642	0.85
74_Q	132_D	0.637	0.85
39_D	42_H	0.633	0.84
105_T	123_T	0.628	0.84
79_G	111_V	0.628	0.84
55_I	115_N	0.628	0.84
23_R	81_A	0.627	0.84
43_P	103_G	0.626	0.84
12_S	106_K	0.625	0.83
38_I	45_L	0.625	0.83
86_M	92_L	0.624	0.83
36_C	92_L	0.621	0.83
55_I	62_R	0.615	0.82
60_L	63_L	0.614	0.82
55_I	61_S	0.613	0.82
12_S	93_L	0.607	0.82
12_S	85_Q	0.604	0.81
78_L	113_Q	0.594	0.80
74_Q	116_K	0.594	0.80
24_E	89_A	0.592	0.80
37_T	53_W	0.590	0.80
23_R	90_G	0.589	0.80
108_V	122_E	0.586	0.79
100_Q	126_H	0.578	0.78
40_I	43_P	0.574	0.78
111_V	128_Q	0.568	0.77
71_R	74_Q	0.568	0.77
3_R	60_L	0.567	0.77
93_L	99_R	0.567	0.77
5_A	109_M	0.563	0.77
38_I	101_H	0.563	0.77
22_Y	39_D	0.563	0.77
66_M	73_V	0.562	0.76
40_I	73_V	0.559	0.76
53_W	81_A	0.553	0.75
68_P	137_Q	0.553	0.75
60_L	78_L	0.549	0.75
57_E	78_L	0.548	0.75
53_W	63_L	0.544	0.74
5_A	125_W	0.542	0.74
34_M	92_L	0.541	0.74
27_L	34_M	0.540	0.74
48_Y	52_E	0.536	0.73
76_L	132_D	0.536	0.73
45_L	98_L	0.532	0.72
80_H	129_V	0.525	0.71
47_L	92_L	0.524	0.71
51_P	83_E	0.522	0.71
58_Q	130_K	0.521	0.71
72_R	132_D	0.521	0.71
81_A	120_W	0.521	0.71
61_S	78_L	0.521	0.71
22_Y	110_L	0.519	0.71
74_Q	79_G	0.519	0.71
16_L	90_G	0.517	0.70
56_I	65_S	0.516	0.70
130_K	133_I	0.515	0.70
124_T	128_Q	0.514	0.70
22_Y	80_H	0.513	0.70
52_E	56_I	0.509	0.69
42_H	75_R	0.507	0.69
98_L	102_A	0.505	0.69
35_V	49_P	0.505	0.69
21_R	112_G	0.504	0.68
68_P	131_E	0.503	0.68
35_V	44_C	0.502	0.68
72_R	131_E	0.502	0.68
5_A	79_G	0.501	0.68
77_L	80_H	0.500	0.68
43_P	102_A	0.500	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1n0eA	5	0.9013	100	0.083	Contact Map
2glwA	1	0.5987	99.7	0.628	Contact Map
1yfbA	2	0.3355	94.5	0.874	Contact Map
2w1tA	2	0.9276	94.5	0.874	Contact Map
2l66A	2	0.3421	91.3	0.887	Contact Map
1mvfD	1	0.2895	75.2	0.908	Contact Map
2mrnA	2	0.3355	54	0.921	Contact Map
3o27A	2	0.3355	27.9	0.933	Contact Map
3d55A	4	0.5197	18.7	0.938	Contact Map
3vkgA	2	0.9342	6.5	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.