HYAD - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HYAD - Hydrogenase 1 maturation protease

UniProt:	P19930	Sequences: MSEQRVVVMGLGNLLWADEGFGVRVAERLYAHYHWPEYVEIVDGGTQGLNLLGYVESASHLLILDAIDYGLEPGTLRTYAGERIPAYLSAKKMSLHQNSFSEVLALADIRGHLPAHIALVGLQPAMLDDYGGSLSELAREQLPAAEQAALAQLAAWGIVPQPANESRCLNYDCLSMENYEGVRLRQYRMTQEEQG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10471
Length:	195 (152)
Sequences:	1063 (807)
Seq/√Len:	65.4

ECOLI - HYAD HYBD HYCI

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
125_A	137_L	5.722	1.00
26_A	41_I	3.795	1.00
24_R	27_E	3.023	1.00
78_T	152_Q	2.992	1.00
64_L	149_A	2.937	1.00
25_V	64_L	2.551	1.00
68_D	123_Q	2.438	1.00
21_F	122_L	2.348	1.00
5_R	59_S	2.138	1.00
120_V	145_A	2.106	1.00
40_E	58_A	2.022	1.00
122_L	138_A	2.016	1.00
78_T	120_V	2.015	1.00
17_A	126_M	2.014	1.00
148_A	151_A	1.998	1.00
124_P	127_L	1.946	1.00
60_H	156_W	1.940	1.00
59_S	115_A	1.901	1.00
70_G	123_Q	1.880	1.00
60_H	116_H	1.877	1.00
62_L	156_W	1.795	1.00
62_L	149_A	1.793	1.00
67_I	121_G	1.753	1.00
32_H	150_L	1.752	1.00
28_R	146_E	1.751	1.00
25_V	142_L	1.749	1.00
72_E	75_T	1.720	0.99
152_Q	155_A	1.696	0.99
14_L	23_V	1.677	0.99
71_L	77_R	1.668	0.99
28_R	32_H	1.652	0.99
136_E	140_E	1.619	0.99
26_A	64_L	1.602	0.99
120_V	149_A	1.578	0.99
14_L	19_E	1.544	0.99
143_P	147_Q	1.541	0.99
136_E	139_R	1.540	0.99
78_T	118_A	1.513	0.99
56_E	112_H	1.504	0.99
71_L	75_T	1.472	0.98
7_V	42_V	1.455	0.98
138_A	141_Q	1.448	0.98
8_V	153_L	1.428	0.98
6_V	158_I	1.411	0.98
76_L	144_A	1.384	0.98
21_F	145_A	1.373	0.97
71_L	123_Q	1.361	0.97
16_W	19_E	1.358	0.97
64_L	145_A	1.349	0.97
122_L	145_A	1.307	0.97
69_Y	77_R	1.298	0.96
141_Q	145_A	1.279	0.96
141_Q	144_A	1.273	0.96
36_P	39_V	1.261	0.96
28_R	143_P	1.252	0.96
122_L	141_Q	1.246	0.95
32_H	143_P	1.246	0.95
7_V	58_A	1.229	0.95
35_W	150_L	1.227	0.95
24_R	133_S	1.199	0.94
77_R	123_Q	1.196	0.94
69_Y	123_Q	1.150	0.93
23_V	43_D	1.147	0.93
80_A	116_H	1.122	0.92
6_V	153_L	1.114	0.92
6_V	60_H	1.072	0.90
23_V	26_A	1.069	0.90
25_V	146_E	1.061	0.90
56_E	110_R	1.043	0.89
99_S	102_E	1.042	0.89
118_A	152_Q	1.039	0.89
61_L	117_I	1.031	0.89
33_Y	157_G	1.029	0.88
63_I	117_I	1.021	0.88
10_G	22_G	1.011	0.88
23_V	124_P	1.006	0.87
116_H	156_W	1.005	0.87
76_L	145_A	1.002	0.87
35_W	41_I	0.987	0.86
153_L	158_I	0.986	0.86
17_A	131_G	0.977	0.86
62_L	152_Q	0.975	0.86
28_R	31_A	0.972	0.85
143_P	146_E	0.969	0.85
10_G	26_A	0.965	0.85
21_F	138_A	0.944	0.84
76_L	122_L	0.939	0.83
153_L	157_G	0.939	0.83
151_A	154_A	0.901	0.81
78_T	148_A	0.901	0.81
80_A	118_A	0.894	0.80
20_G	134_L	0.879	0.79
42_V	54_Y	0.870	0.78
13_N	20_G	0.868	0.78
34_H	38_Y	0.859	0.77
126_M	135_S	0.842	0.76
28_R	139_R	0.836	0.76
62_L	120_V	0.832	0.75
150_L	157_G	0.830	0.75
144_A	147_Q	0.829	0.75
49_L	106_L	0.816	0.74
152_Q	156_W	0.806	0.73
73_P	123_Q	0.794	0.72
29_L	35_W	0.791	0.71
43_D	46_T	0.787	0.71
73_P	140_E	0.777	0.70
108_D	113_L	0.775	0.70
19_E	44_G	0.774	0.70
44_G	51_L	0.767	0.69
27_E	30_Y	0.762	0.69
16_W	50_N	0.761	0.68
80_A	83_R	0.760	0.68
144_A	148_A	0.759	0.68
19_E	23_V	0.755	0.68
52_L	107_A	0.750	0.67
20_G	24_R	0.748	0.67
105_A	108_D	0.747	0.67
75_T	123_Q	0.746	0.67
120_V	152_Q	0.745	0.67
95_L	130_Y	0.745	0.67
29_L	64_L	0.744	0.67
48_G	99_S	0.741	0.66
126_M	137_L	0.740	0.66
9_M	44_G	0.739	0.66
142_L	145_A	0.738	0.66
133_S	139_R	0.734	0.66
11_L	51_L	0.733	0.66
20_G	43_D	0.732	0.65
60_H	118_A	0.732	0.65
147_Q	151_A	0.730	0.65
137_L	140_E	0.725	0.65
100_F	103_V	0.723	0.65
33_Y	150_L	0.708	0.63
67_I	77_R	0.705	0.63
7_V	61_L	0.700	0.62
69_Y	75_T	0.697	0.62
49_L	53_G	0.689	0.61
21_F	66_A	0.684	0.60
103_V	110_R	0.677	0.59
19_E	124_P	0.673	0.59
12_G	18_D	0.667	0.58
65_D	96_H	0.667	0.58
139_R	142_L	0.661	0.58
95_L	98_N	0.659	0.57
49_L	94_S	0.656	0.57
111_G	151_A	0.651	0.56
53_G	97_Q	0.646	0.56
19_E	96_H	0.643	0.56
118_A	123_Q	0.643	0.56
20_G	23_V	0.639	0.55
63_I	100_F	0.637	0.55
34_H	146_E	0.636	0.55
50_N	94_S	0.634	0.55
42_V	71_L	0.634	0.55
5_R	117_I	0.626	0.54
43_D	48_G	0.626	0.54
13_N	45_G	0.624	0.53
148_A	152_Q	0.621	0.53
58_A	114_P	0.620	0.53
17_A	61_L	0.615	0.52
94_S	102_E	0.613	0.52
29_L	124_P	0.612	0.52
19_E	24_R	0.606	0.51
25_V	145_A	0.606	0.51
33_Y	158_I	0.605	0.51
29_L	41_I	0.605	0.51
44_G	94_S	0.603	0.51
12_G	22_G	0.600	0.51
79_Y	130_Y	0.597	0.50
145_A	152_Q	0.592	0.50
15_L	44_G	0.591	0.49
8_V	38_Y	0.587	0.49
86_A	115_A	0.586	0.49
29_L	150_L	0.583	0.49
52_L	106_L	0.581	0.48
89_S	101_S	0.578	0.48
64_L	138_A	0.576	0.48
44_G	53_G	0.573	0.47
47_Q	103_V	0.572	0.47
94_S	122_L	0.572	0.47
16_W	100_F	0.570	0.47
20_G	45_G	0.570	0.47
59_S	111_G	0.569	0.47
122_L	148_A	0.567	0.47
27_E	43_D	0.562	0.46
74_G	141_Q	0.560	0.46
103_V	123_Q	0.560	0.46
101_S	111_G	0.551	0.45
26_A	43_D	0.551	0.45
53_G	56_E	0.551	0.45
50_N	98_N	0.550	0.45
20_G	94_S	0.549	0.45
37_E	139_R	0.549	0.45
72_E	125_A	0.547	0.44
5_R	60_H	0.547	0.44
32_H	147_Q	0.542	0.44
60_H	115_A	0.541	0.44
7_V	30_Y	0.540	0.44
7_V	27_E	0.540	0.44
17_A	132_G	0.538	0.43
91_K	95_L	0.538	0.43
21_F	114_P	0.536	0.43
110_R	119_L	0.535	0.43
72_E	155_A	0.534	0.43
58_A	61_L	0.530	0.42
36_P	158_I	0.528	0.42
67_I	101_S	0.527	0.42
67_I	157_G	0.524	0.42
69_Y	79_Y	0.524	0.42
49_L	99_S	0.524	0.42
11_L	44_G	0.523	0.42
5_R	151_A	0.522	0.41
19_E	46_T	0.521	0.41
19_E	109_I	0.519	0.41
56_E	98_N	0.518	0.41
16_W	98_N	0.515	0.41
47_Q	79_Y	0.512	0.40
37_E	72_E	0.512	0.40
34_H	151_A	0.510	0.40
9_M	42_V	0.507	0.40
116_H	152_Q	0.506	0.40
82_E	151_A	0.504	0.39
18_D	135_S	0.504	0.39
5_R	8_V	0.504	0.39
104_L	108_D	0.503	0.39
77_R	121_G	0.503	0.39
121_G	124_P	0.502	0.39
6_V	156_W	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1cfzA	1	0.8256	100	0.289	Contact Map
2e85A	2	0.7949	100	0.373	Contact Map
3pu6A	1	0.6821	100	0.395	Contact Map
1c8bA	3	0.7128	95.8	0.884	Contact Map
2hk9A	1	0.6974	79.7	0.919	Contact Map
3b1fA	2	0.8769	75.1	0.923	Contact Map
2rcyA	5	0.8872	74.7	0.923	Contact Map
3triA	2	0.8872	74.1	0.923	Contact Map
2dbqA	2	0.8256	72.6	0.924	Contact Map
2d0iA	2	0.8462	71	0.925	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.