INSJ - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

INSJ - Insertion element IS150 uncharacterized 19.7 kDa protein

UniProt:	P19768	Sequences: MSKPKYPFEKRLEVVNHYFTTDDGYRIISARFGVPRTQVRTWVALYEKHGEKGLIPKPKGVSADPELRIKVVKAVIEQHMSLNQAAAHFMLAGSGSVARWLKVYEERGEAGLRALKIGTKRNIAISVDPEKAASALELSKDRRIEDLERQVRFLETRLMYLKKLKALAHPTKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG40010
Length:	173 (158)
Sequences:	896 (702)
Seq/√Len:	55.9

ECOLI - INSJ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
150_Q	155_E	5.986	1.00
143_R	148_E	3.197	1.00
143_R	146_D	2.946	1.00
71_V	89_F	2.945	1.00
25_Y	43_V	2.774	1.00
14_V	39_V	2.578	1.00
107_R	111_G	2.547	1.00
17_H	32_F	2.402	1.00
75_V	85_A	2.349	1.00
72_V	101_L	2.330	1.00
14_V	28_I	2.309	1.00
6_Y	42_W	2.295	1.00
71_V	97_V	2.287	1.00
17_H	28_I	2.180	1.00
74_A	78_Q	2.121	1.00
10_K	14_V	2.099	1.00
14_V	32_F	2.082	1.00
153_F	156_T	2.023	1.00
144_I	148_E	2.018	1.00
67_L	71_V	1.947	1.00
6_Y	10_K	1.915	1.00
152_R	155_E	1.816	0.99
158_L	161_L	1.808	0.99
76_I	101_L	1.781	0.99
157_R	162_K	1.780	0.99
163_K	166_A	1.765	0.99
17_H	31_R	1.756	0.99
165_K	168_A	1.676	0.99
108_G	112_L	1.668	0.99
151_V	154_L	1.653	0.99
17_H	23_D	1.644	0.99
151_V	158_L	1.633	0.99
72_V	76_I	1.625	0.99
28_I	32_F	1.621	0.99
114_A	117_I	1.609	0.98
74_A	89_F	1.605	0.98
99_R	103_V	1.533	0.98
139_S	142_R	1.521	0.98
144_I	151_V	1.469	0.97
102_K	106_E	1.394	0.96
28_I	39_V	1.377	0.96
154_L	158_L	1.362	0.96
157_R	161_L	1.360	0.96
15_V	54_L	1.359	0.96
165_K	169_H	1.359	0.96
12_L	16_N	1.354	0.96
156_T	163_K	1.336	0.95
35_P	83_N	1.304	0.95
75_V	101_L	1.301	0.94
108_G	111_G	1.299	0.94
72_V	97_V	1.297	0.94
152_R	159_M	1.289	0.94
18_Y	43_V	1.289	0.94
152_R	156_T	1.271	0.94
24_G	27_I	1.244	0.93
92_A	96_S	1.241	0.93
117_I	121_R	1.203	0.92
142_R	145_E	1.194	0.91
103_V	107_R	1.190	0.91
38_Q	41_T	1.181	0.91
156_T	159_M	1.179	0.91
160_Y	164_L	1.166	0.90
39_V	43_V	1.154	0.90
101_L	105_E	1.148	0.90
151_V	155_E	1.146	0.90
64_D	68_R	1.127	0.89
14_V	17_H	1.120	0.89
85_A	89_F	1.093	0.87
82_L	101_L	1.087	0.87
118_G	121_R	1.086	0.87
25_Y	40_R	1.070	0.86
10_K	34_V	1.065	0.86
23_D	27_I	1.052	0.85
26_R	40_R	1.029	0.84
72_V	75_V	1.026	0.84
64_D	67_L	1.025	0.84
63_A	92_A	1.017	0.83
4_P	56_P	1.015	0.83
49_H	87_A	1.011	0.83
44_A	47_E	1.007	0.83
82_L	98_A	1.001	0.82
44_A	87_A	0.995	0.82
95_G	98_A	0.993	0.82
18_Y	28_I	0.984	0.81
11_R	18_Y	0.973	0.80
46_Y	53_G	0.967	0.80
147_L	151_V	0.949	0.79
74_A	88_H	0.932	0.77
40_R	43_V	0.916	0.76
18_Y	25_Y	0.908	0.76
80_M	84_Q	0.893	0.74
13_E	17_H	0.893	0.74
166_A	169_H	0.887	0.74
15_V	18_Y	0.881	0.73
26_R	36_R	0.878	0.73
57_K	92_A	0.870	0.72
149_R	152_R	0.864	0.72
72_V	85_A	0.862	0.72
34_V	39_V	0.857	0.71
85_A	88_H	0.853	0.71
79_H	85_A	0.843	0.70
48_K	87_A	0.841	0.70
116_K	119_T	0.839	0.70
50_G	167_L	0.826	0.68
141_D	151_V	0.823	0.68
64_D	129_P	0.820	0.68
7_P	11_R	0.818	0.68
63_A	68_R	0.818	0.68
8_F	12_L	0.817	0.68
14_V	34_V	0.816	0.67
168_A	171_T	0.813	0.67
80_M	88_H	0.811	0.67
7_P	10_K	0.805	0.66
103_V	111_G	0.803	0.66
140_K	143_R	0.803	0.66
150_Q	153_F	0.789	0.65
74_A	80_M	0.785	0.64
10_K	42_W	0.782	0.64
145_E	149_R	0.775	0.63
49_H	52_K	0.773	0.63
112_L	118_G	0.766	0.63
158_L	162_K	0.762	0.62
63_A	67_L	0.756	0.62
8_F	55_I	0.753	0.61
8_F	54_L	0.753	0.61
75_V	78_Q	0.753	0.61
145_E	148_E	0.749	0.61
142_R	146_D	0.746	0.61
96_S	99_R	0.744	0.60
80_M	85_A	0.743	0.60
40_R	83_N	0.730	0.59
19_F	43_V	0.727	0.59
24_G	29_S	0.727	0.59
61_V	92_A	0.724	0.58
15_V	19_F	0.714	0.57
37_T	40_R	0.709	0.57
74_A	85_A	0.706	0.56
156_T	166_A	0.705	0.56
65_P	113_R	0.704	0.56
30_A	129_P	0.698	0.55
42_W	46_Y	0.695	0.55
12_L	51_E	0.691	0.55
35_P	40_R	0.677	0.53
10_K	17_H	0.675	0.53
82_L	85_A	0.674	0.53
153_F	158_L	0.669	0.52
73_K	77_E	0.669	0.52
122_N	125_I	0.667	0.52
8_F	51_E	0.663	0.52
41_T	97_V	0.660	0.51
114_A	119_T	0.659	0.51
104_Y	108_G	0.658	0.51
23_D	32_F	0.656	0.51
141_D	146_D	0.650	0.50
164_L	169_H	0.649	0.50
18_Y	42_W	0.647	0.50
95_G	101_L	0.637	0.49
115_L	119_T	0.634	0.49
156_T	165_K	0.620	0.47
82_L	93_G	0.614	0.46
164_L	170_P	0.614	0.46
33_G	64_D	0.612	0.46
40_R	62_S	0.612	0.46
12_L	90_M	0.605	0.45
35_P	38_Q	0.603	0.45
66_E	70_K	0.599	0.45
140_K	144_I	0.599	0.45
130_E	171_T	0.599	0.45
41_T	91_L	0.596	0.44
5_K	162_K	0.594	0.44
114_A	118_G	0.594	0.44
31_R	34_V	0.592	0.44
153_F	160_Y	0.591	0.44
44_A	54_L	0.591	0.44
102_K	110_A	0.583	0.43
68_R	72_V	0.581	0.43
34_V	40_R	0.581	0.43
149_R	156_T	0.580	0.43
107_R	120_K	0.580	0.43
19_F	47_E	0.579	0.43
12_L	46_Y	0.579	0.43
68_R	100_W	0.578	0.43
115_L	118_G	0.573	0.42
160_Y	167_L	0.570	0.42
83_N	87_A	0.569	0.42
70_K	73_K	0.569	0.42
67_L	89_F	0.569	0.42
65_P	72_V	0.565	0.41
19_F	42_W	0.565	0.41
48_K	97_V	0.564	0.41
10_K	13_E	0.564	0.41
84_Q	88_H	0.563	0.41
73_K	104_Y	0.562	0.41
84_Q	159_M	0.562	0.41
44_A	83_N	0.561	0.41
157_R	166_A	0.558	0.40
37_T	94_S	0.556	0.40
23_D	31_R	0.555	0.40
110_A	113_R	0.554	0.40
127_V	130_E	0.553	0.40
29_S	108_G	0.549	0.39
68_R	115_L	0.548	0.39
116_K	143_R	0.547	0.39
38_Q	95_G	0.545	0.39
46_Y	51_E	0.544	0.39
28_I	68_R	0.539	0.38
20_T	23_D	0.537	0.38
86_A	90_M	0.537	0.38
149_R	153_F	0.537	0.38
63_A	154_L	0.534	0.38
163_K	167_L	0.533	0.38
82_L	97_V	0.531	0.38
10_K	28_I	0.530	0.38
111_G	160_Y	0.530	0.38
65_P	110_A	0.530	0.38
159_M	168_A	0.529	0.37
69_I	72_V	0.526	0.37
7_P	151_V	0.520	0.37
72_V	77_E	0.518	0.36
113_R	117_I	0.518	0.36
41_T	45_L	0.518	0.36
15_V	43_V	0.516	0.36
87_A	91_L	0.514	0.36
78_Q	88_H	0.513	0.36
45_L	68_R	0.512	0.36
28_I	31_R	0.511	0.36
9_E	106_E	0.511	0.36
159_M	164_L	0.511	0.36
29_S	39_V	0.509	0.35
109_E	120_K	0.506	0.35
42_W	71_V	0.506	0.35
155_E	166_A	0.505	0.35
144_I	150_Q	0.504	0.35
39_V	84_Q	0.501	0.35
76_I	105_E	0.501	0.35
110_A	116_K	0.500	0.35
45_L	97_V	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2rn7A	1	0.5491	99.6	0.664	Contact Map
2jn6A	1	0.5549	99.4	0.706	Contact Map
1u78A	1	0.5838	99.3	0.721	Contact Map
1pdnC	1	0.578	99.2	0.723	Contact Map
2k27A	1	0.7341	99.2	0.724	Contact Map
1k78A	1	0.5954	99.1	0.736	Contact Map
1hlvA	1	0.6301	99.1	0.743	Contact Map
2oa4A	1	0.422	98.9	0.759	Contact Map
2elhA	1	0.4046	98.6	0.786	Contact Map
2jrtA	1	0.3931	98.4	0.797	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.