INSA7 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

INSA7 - Insertion element IS1 7 protein InsA

UniProt:	P19767	Sequences: MASISIRCPSCSATEGVVRNGKSTAGHQRYLCSPCRKTWQLQFTYTASQPGKHQKIIDMAMNGVGCRASARIMGVGLNTVLRHLKNSGRSR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG40001
Length:	91 (73)
Sequences:	587 (530)
Seq/√Len:	62.0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_N	24_T	3.109	1.00
8_C	11_C	2.660	1.00
7_R	11_C	2.526	1.00
72_I	75_V	2.230	1.00
59_M	62_N	2.215	1.00
21_G	49_Q	2.164	1.00
48_S	52_K	1.863	1.00
32_C	35_C	1.834	1.00
20_N	32_C	1.753	0.99
57_I	62_N	1.724	0.99
35_C	48_S	1.674	0.99
45_Y	48_S	1.669	0.99
62_N	66_C	1.643	0.99
72_I	76_G	1.636	0.99
62_N	75_V	1.548	0.99
32_C	48_S	1.476	0.98
22_K	27_H	1.433	0.98
74_G	78_N	1.416	0.98
24_T	32_C	1.412	0.97
59_M	66_C	1.363	0.97
25_A	28_Q	1.362	0.97
70_A	78_N	1.331	0.96
73_M	76_G	1.326	0.96
20_N	35_C	1.315	0.96
11_C	20_N	1.308	0.96
16_G	19_R	1.290	0.96
46_T	49_Q	1.284	0.96
14_T	42_Q	1.238	0.95
22_K	29_R	1.197	0.94
11_C	39_W	1.194	0.93
66_C	75_V	1.158	0.92
25_A	29_R	1.157	0.92
62_N	72_I	1.136	0.92
22_K	26_G	1.133	0.92
19_R	22_K	1.102	0.90
31_L	36_R	1.082	0.90
24_T	48_S	1.065	0.89
40_Q	47_A	1.061	0.89
30_Y	46_T	1.008	0.86
43_F	47_A	0.996	0.85
6_I	43_F	0.993	0.85
15_E	43_F	0.980	0.84
58_D	73_M	0.953	0.83
30_Y	51_G	0.952	0.82
27_H	30_Y	0.932	0.81
18_V	21_G	0.921	0.80
57_I	66_C	0.888	0.78
66_C	78_N	0.884	0.78
22_K	25_A	0.865	0.76
17_V	24_T	0.855	0.75
60_A	70_A	0.852	0.75
61_M	67_R	0.849	0.75
19_R	25_A	0.847	0.74
16_G	23_S	0.844	0.74
42_Q	46_T	0.844	0.74
58_D	61_M	0.843	0.74
33_S	42_Q	0.840	0.74
37_K	50_P	0.831	0.73
23_S	27_H	0.831	0.73
64_V	68_A	0.810	0.71
29_R	48_S	0.804	0.71
56_I	71_R	0.802	0.70
15_E	44_T	0.789	0.69
8_C	21_G	0.759	0.66
68_A	76_G	0.754	0.66
71_R	78_N	0.720	0.62
63_G	76_G	0.719	0.62
20_N	48_S	0.716	0.62
59_M	75_V	0.709	0.61
31_L	38_T	0.706	0.61
41_L	44_T	0.692	0.59
73_M	77_L	0.680	0.58
12_S	18_V	0.674	0.57
28_Q	34_P	0.665	0.56
59_M	71_R	0.662	0.56
54_Q	57_I	0.660	0.55
69_S	72_I	0.656	0.55
18_V	34_P	0.655	0.55
59_M	72_I	0.653	0.55
65_G	70_A	0.653	0.55
33_S	58_D	0.642	0.53
26_G	29_R	0.634	0.52
39_W	48_S	0.627	0.52
7_R	35_C	0.624	0.51
26_G	30_Y	0.618	0.51
75_V	78_N	0.614	0.50
56_I	59_M	0.613	0.50
17_V	27_H	0.602	0.49
21_G	39_W	0.600	0.49
64_V	76_G	0.597	0.48
10_S	25_A	0.594	0.48
18_V	22_K	0.585	0.47
69_S	74_G	0.582	0.47
13_A	16_G	0.576	0.46
28_Q	47_A	0.570	0.45
11_C	24_T	0.569	0.45
34_P	54_Q	0.567	0.45
45_Y	52_K	0.565	0.45
7_R	20_N	0.564	0.44
7_R	24_T	0.562	0.44
50_P	54_Q	0.552	0.43
15_E	36_R	0.540	0.42
61_M	68_A	0.536	0.41
12_S	16_G	0.536	0.41
6_I	11_C	0.529	0.41
49_Q	54_Q	0.523	0.40
41_L	49_Q	0.523	0.40
36_R	73_M	0.518	0.39
54_Q	70_A	0.502	0.38
35_C	52_K	0.500	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2i13A	1	0.8681	99.4	0.325	Contact Map
3w5kB	1	0.9121	99.4	0.334	Contact Map
2m9aA	1	0.9121	99.4	0.34	Contact Map
2rsjA	1	0.9121	99.4	0.343	Contact Map
2dmdA	1	0.967	99.4	0.346	Contact Map
2n25A	1	0.3077	99.4	0.35	Contact Map
2kmkA	1	0.8901	99.4	0.35	Contact Map
4x9jA	1	0.8901	99.4	0.357	Contact Map
2yt9A	1	0.9341	99.4	0.358	Contact Map
2ee8A	1	0.978	99.3	0.363	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.