DMSB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DMSB - Anaerobic dimethyl sulfoxide reductase chain B

UniProt:	P18776	Sequences: MTTQYGFFIDSSRCTGCKTCELACKDYKDLTPEVSFRRIYEYAGGDWQEDNGVWHQNVFAYYLSISCNHCEDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNETKGHMTKCDGCYDRVAEGKKPICVESCPLRALDFGPIDELRKKHGDLAAVAPLPRAHFTKPNIVIKPNANSRPTGDTTGYLANPKEV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10233
Length:	205 (176)
Sequences:	3451 (1926)
Seq/√Len:	145.2

ECOLI - DMSB YNFG NRFC YDHX FDOH FDNH HYBA HYFA YDHY HYDN YSAA HYCB YGFS NARY NARH AEGA YGFT
BACSU - NARH
HALSA - DMSB
SULSO - Q97XX9 Q97V38 Q97V75

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
76_T	84_M	3.072	1.00
103_R	116_Y	2.881	1.00
78_V	108_A	2.841	1.00
27_Y	131_D	2.816	1.00
71_E	180_N	2.646	1.00
139_P	142_V	2.517	1.00
106_H	123_M	2.489	1.00
84_M	114_P	2.386	1.00
7_F	128_G	2.284	1.00
84_M	94_V	2.223	1.00
142_V	150_L	2.133	1.00
73_P	86_K	2.126	1.00
130_Y	134_A	2.110	1.00
151_D	161_K	2.067	1.00
6_G	155_I	1.969	1.00
87_R	134_A	1.952	1.00
36_F	124_T	1.857	1.00
78_V	104_Y	1.848	1.00
132_R	137_K	1.832	1.00
138_K	143_E	1.818	1.00
9_I	150_L	1.810	1.00
116_Y	123_M	1.784	1.00
14_C	20_C	1.774	1.00
53_V	56_Q	1.770	1.00
14_C	17_C	1.740	1.00
17_C	20_C	1.709	1.00
91_F	128_G	1.707	1.00
103_R	106_H	1.706	1.00
18_K	21_E	1.705	1.00
28_K	127_D	1.683	1.00
161_K	164_D	1.666	1.00
91_F	133_V	1.664	1.00
85_H	93_V	1.652	1.00
15_T	147_L	1.639	1.00
76_T	86_K	1.622	1.00
79_C	105_C	1.622	1.00
117_N	124_T	1.611	1.00
170_P	173_R	1.603	1.00
155_I	159_R	1.591	1.00
8_F	162_H	1.585	1.00
95_D	98_V	1.575	1.00
4_Q	71_E	1.560	1.00
72_D	77_K	1.543	1.00
87_R	93_V	1.536	1.00
157_E	160_K	1.529	1.00
27_Y	132_R	1.500	1.00
99_C	105_C	1.500	1.00
23_A	144_S	1.495	1.00
79_C	99_C	1.489	1.00
132_R	143_E	1.487	1.00
14_C	145_C	1.481	1.00
85_H	95_D	1.480	1.00
128_G	181_I	1.416	1.00
117_N	120_K	1.402	1.00
17_C	145_C	1.350	1.00
36_F	39_I	1.337	1.00
93_V	130_Y	1.330	1.00
114_P	123_M	1.307	1.00
154_P	157_E	1.283	1.00
72_D	178_K	1.266	1.00
87_R	91_F	1.263	1.00
161_K	165_L	1.251	1.00
153_G	157_E	1.239	1.00
81_S	84_M	1.237	1.00
66_S	181_I	1.234	1.00
8_F	184_K	1.229	1.00
151_D	165_L	1.229	1.00
128_G	133_V	1.227	1.00
160_K	163_G	1.223	1.00
170_P	178_K	1.221	1.00
73_P	76_T	1.217	1.00
9_I	64_S	1.207	1.00
20_C	145_C	1.202	1.00
28_K	131_D	1.192	1.00
99_C	102_C	1.176	1.00
74_A	177_T	1.173	1.00
103_R	118_E	1.170	1.00
12_S	184_K	1.163	1.00
6_G	158_L	1.134	0.99
138_K	142_V	1.129	0.99
151_D	162_H	1.109	0.99
19_T	144_S	1.100	0.99
5_Y	154_P	1.095	0.99
160_K	164_D	1.088	0.99
159_R	164_D	1.081	0.99
39_I	45_G	1.079	0.99
126_C	129_C	1.063	0.99
66_S	150_L	1.055	0.99
94_V	123_M	1.044	0.99
12_S	169_A	1.037	0.99
128_G	152_F	1.021	0.99
27_Y	140_I	1.017	0.99
65_I	171_L	1.016	0.99
166_A	182_V	1.016	0.99
81_S	100_I	1.012	0.99
163_G	166_A	1.008	0.99
133_V	152_F	1.007	0.99
87_R	130_Y	0.987	0.98
164_D	168_V	0.977	0.98
172_P	175_H	0.977	0.98
11_S	64_S	0.965	0.98
93_V	127_D	0.962	0.98
45_G	53_V	0.962	0.98
118_E	121_G	0.951	0.98
163_G	167_A	0.945	0.98
96_E	122_H	0.940	0.98
4_Q	180_N	0.938	0.98
164_D	167_A	0.932	0.98
64_S	150_L	0.927	0.98
170_P	175_H	0.923	0.98
38_R	115_Q	0.921	0.98
86_K	92_V	0.918	0.98
103_R	123_M	0.916	0.98
170_P	182_V	0.913	0.97
176_F	183_I	0.911	0.97
137_K	143_E	0.910	0.97
102_C	105_C	0.908	0.97
104_Y	107_M	0.901	0.97
74_A	108_A	0.890	0.97
40_Y	44_G	0.883	0.97
53_V	57_N	0.878	0.97
7_F	142_V	0.878	0.97
91_F	130_Y	0.874	0.97
83_A	98_V	0.861	0.96
89_D	134_A	0.857	0.96
28_K	140_I	0.846	0.96
79_C	102_C	0.846	0.96
35_S	39_I	0.838	0.96
37_R	150_L	0.823	0.95
37_R	42_Y	0.822	0.95
127_D	131_D	0.821	0.95
19_T	22_L	0.821	0.95
80_P	105_C	0.817	0.95
10_D	13_R	0.812	0.95
81_S	85_H	0.808	0.95
5_Y	152_F	0.808	0.95
54_W	57_N	0.805	0.95
6_G	180_N	0.802	0.95
76_T	85_H	0.790	0.94
81_S	102_C	0.789	0.94
39_I	42_Y	0.789	0.94
37_R	41_E	0.783	0.94
78_V	107_M	0.777	0.94
8_F	165_L	0.775	0.94
23_A	140_I	0.773	0.94
179_P	183_I	0.773	0.94
80_P	100_I	0.762	0.93
94_V	114_P	0.753	0.93
41_E	44_G	0.747	0.92
9_I	66_S	0.744	0.92
132_R	140_I	0.740	0.92
125_K	129_C	0.732	0.92
165_L	184_K	0.730	0.91
36_F	40_Y	0.727	0.91
115_Q	124_T	0.724	0.91
166_A	169_A	0.721	0.91
13_R	149_A	0.720	0.91
5_Y	133_V	0.716	0.91
116_Y	121_G	0.714	0.91
71_E	86_K	0.708	0.90
117_N	121_G	0.703	0.90
78_V	84_M	0.700	0.90
167_A	174_A	0.688	0.89
173_R	176_F	0.680	0.88
104_Y	108_A	0.680	0.88
118_E	124_T	0.680	0.88
15_T	146_P	0.675	0.88
148_R	151_D	0.659	0.87
176_F	179_P	0.659	0.87
80_P	99_C	0.658	0.87
159_R	163_G	0.657	0.87
158_L	163_G	0.655	0.86
177_T	180_N	0.651	0.86
162_H	165_L	0.650	0.86
96_E	120_K	0.647	0.86
34_V	37_R	0.647	0.86
89_D	93_V	0.647	0.86
42_Y	45_G	0.642	0.85
169_A	184_K	0.642	0.85
16_G	20_C	0.641	0.85
116_Y	120_K	0.640	0.85
138_K	151_D	0.639	0.85
7_F	64_S	0.639	0.85
165_L	169_A	0.633	0.85
81_S	98_V	0.632	0.84
35_S	38_R	0.631	0.84
4_Q	155_I	0.630	0.84
38_R	45_G	0.627	0.84
11_S	63_L	0.626	0.84
36_F	41_E	0.624	0.84
41_E	60_A	0.620	0.83
8_F	151_D	0.617	0.83
64_S	183_I	0.617	0.83
4_Q	156_D	0.615	0.83
165_L	168_V	0.612	0.82
106_H	116_Y	0.612	0.82
174_A	177_T	0.609	0.82
153_G	158_L	0.609	0.82
27_Y	127_D	0.608	0.82
19_T	26_D	0.608	0.82
86_K	91_F	0.604	0.82
39_I	44_G	0.602	0.81
64_S	68_N	0.595	0.81
38_R	43_A	0.595	0.81
39_I	43_A	0.594	0.81
71_E	178_K	0.594	0.81
66_S	128_G	0.593	0.80
35_S	40_Y	0.591	0.80
7_F	66_S	0.589	0.80
158_L	162_H	0.582	0.79
51_N	56_Q	0.580	0.79
38_R	42_Y	0.580	0.79
112_G	115_Q	0.579	0.79
19_T	146_P	0.576	0.79
174_A	178_K	0.574	0.78
35_S	42_Y	0.573	0.78
19_T	147_L	0.570	0.78
36_F	42_Y	0.569	0.78
16_G	149_A	0.561	0.77
100_I	104_Y	0.558	0.76
5_Y	91_F	0.556	0.76
139_P	150_L	0.556	0.76
162_H	166_A	0.556	0.76
158_L	161_K	0.556	0.76
31_T	34_V	0.555	0.76
103_R	107_M	0.555	0.76
16_G	62_Y	0.552	0.76
8_F	160_K	0.551	0.75
103_R	124_T	0.549	0.75
9_I	183_I	0.548	0.75
37_R	40_Y	0.547	0.75
124_T	127_D	0.543	0.74
22_L	144_S	0.541	0.74
34_V	38_R	0.539	0.74
21_E	39_I	0.539	0.74
87_R	133_V	0.538	0.74
37_R	66_S	0.538	0.74
100_I	105_C	0.535	0.73
69_H	92_V	0.534	0.73
176_F	184_K	0.533	0.73
5_Y	89_D	0.532	0.73
16_G	19_T	0.530	0.73
8_F	166_A	0.530	0.73
36_F	43_A	0.527	0.72
25_K	30_L	0.527	0.72
154_P	160_K	0.527	0.72
40_Y	43_A	0.524	0.72
171_L	174_A	0.524	0.72
45_G	57_N	0.523	0.72
18_K	22_L	0.522	0.72
37_R	44_G	0.520	0.71
12_S	182_V	0.519	0.71
32_P	36_F	0.518	0.71
33_E	37_R	0.517	0.71
179_P	182_V	0.515	0.71
26_D	143_E	0.512	0.70
80_P	102_C	0.511	0.70
4_Q	86_K	0.508	0.69
175_H	179_P	0.507	0.69
7_F	152_F	0.507	0.69
127_D	130_Y	0.502	0.69
154_P	158_L	0.501	0.68
43_A	60_A	0.501	0.68
33_E	40_Y	0.500	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ivfB	1	0.9902	100	0.352	Contact Map
1ti6B	2	0.9463	100	0.364	Contact Map
1kqfB	3	0.9902	100	0.404	Contact Map
2vpzB	2	0.922	100	0.414	Contact Map
1h0hB	1	0.9512	100	0.418	Contact Map
1q16B	2	1	100	0.448	Contact Map
4z3xE	2	0.8049	100	0.576	Contact Map
3mm5B	2	0.9756	99.8	0.681	Contact Map
1jnrB	1	0.678	99.5	0.757	Contact Map
3gyxB	1	0.7073	99.5	0.762	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.