PRLF - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PRLF - Antitoxin PrlF

UniProt:	P15373	Sequences: MPANARSHAVLTTESKVTIRGQTTIPAPVREALKLKPGQDSIHYEILPGGQVFMCRLGDEQEDHTMNAFLRFLDADIQNNPQKTRPFNIQQGKKLVAGMDVNIDDEIGDDE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10955
Length:	111 (101)
Sequences:	117 (75)
Seq/√Len:	7.5

ECOLI - PRLF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_V	21_G	3.436	0.92
65_T	68_A	3.303	0.90
20_R	107_I	2.350	0.68
27_A	47_L	2.199	0.62
84_T	108_G	2.177	0.61
87_F	100_D	2.164	0.61
19_I	38_G	2.114	0.59
29_V	80_N	1.833	0.48
65_T	77_I	1.823	0.48
47_L	51_Q	1.768	0.46
16_K	38_G	1.750	0.45
92_G	96_V	1.749	0.45
21_G	38_G	1.748	0.45
80_N	83_K	1.731	0.44
29_V	46_I	1.718	0.44
48_P	86_P	1.665	0.41
28_P	56_R	1.563	0.38
21_G	37_P	1.505	0.36
13_T	65_T	1.505	0.36
65_T	72_F	1.491	0.35
59_D	79_N	1.487	0.35
101_V	104_D	1.460	0.34
77_I	84_T	1.451	0.34
37_P	107_I	1.429	0.33
64_H	102_N	1.407	0.32
25_I	58_G	1.384	0.31
47_L	109_D	1.365	0.31
19_I	47_L	1.334	0.30
36_K	80_N	1.305	0.29
34_K	61_Q	1.274	0.28
16_K	41_S	1.270	0.28
58_G	99_M	1.251	0.27
27_A	38_G	1.249	0.27
92_G	110_D	1.249	0.27
79_N	88_N	1.244	0.27
100_D	104_D	1.236	0.26
36_K	82_Q	1.193	0.25
12_T	98_G	1.191	0.25
13_T	32_A	1.176	0.25
75_A	78_Q	1.173	0.25
20_R	44_Y	1.170	0.24
102_N	105_D	1.166	0.24
92_G	97_A	1.154	0.24
60_E	77_I	1.142	0.24
47_L	110_D	1.135	0.23
85_R	108_G	1.124	0.23
37_P	41_S	1.118	0.23
17_V	44_Y	1.118	0.23
53_F	93_K	1.048	0.21
10_V	110_D	1.046	0.21
54_M	62_E	1.029	0.21
78_Q	104_D	1.027	0.21
38_G	53_F	1.024	0.20
47_L	54_M	1.016	0.20
68_A	71_R	1.015	0.20
37_P	40_D	1.000	0.20
15_S	32_A	0.990	0.20
17_V	20_R	0.988	0.20
35_L	40_D	0.962	0.19
66_M	88_N	0.942	0.18
10_V	56_R	0.936	0.18
34_K	88_N	0.929	0.18
35_L	54_M	0.926	0.18
84_T	89_I	0.923	0.18
68_A	96_V	0.898	0.17
46_I	85_R	0.895	0.17
35_L	107_I	0.889	0.17
62_E	94_K	0.883	0.17
83_K	94_K	0.882	0.17
43_H	51_Q	0.868	0.17
17_V	35_L	0.865	0.17
25_I	65_T	0.864	0.17
51_Q	98_G	0.864	0.17
47_L	53_F	0.863	0.17
28_P	108_G	0.863	0.17
11_L	71_R	0.863	0.17
95_L	102_N	0.858	0.16
31_E	47_L	0.856	0.16
9_A	92_G	0.844	0.16
20_R	37_P	0.826	0.16
16_K	36_K	0.814	0.16
21_G	40_D	0.810	0.15
14_E	41_S	0.809	0.15
98_G	101_V	0.804	0.15
65_T	102_N	0.801	0.15
25_I	97_A	0.798	0.15
92_G	98_G	0.783	0.15
20_R	109_D	0.781	0.15
17_V	107_I	0.772	0.15
67_N	105_D	0.766	0.15
48_P	87_F	0.762	0.15
86_P	98_G	0.759	0.14
82_Q	96_V	0.747	0.14
37_P	66_M	0.746	0.14
49_G	98_G	0.745	0.14
32_A	42_I	0.744	0.14
64_H	95_L	0.738	0.14
20_R	48_P	0.736	0.14
79_N	86_P	0.732	0.14
44_Y	54_M	0.728	0.14
73_L	100_D	0.718	0.14
55_C	90_Q	0.718	0.14
34_K	42_I	0.712	0.14
36_K	83_K	0.696	0.13
13_T	54_M	0.693	0.13
25_I	47_L	0.693	0.13
14_E	46_I	0.692	0.13
87_F	99_M	0.687	0.13
72_F	100_D	0.676	0.13
20_R	35_L	0.674	0.13
51_Q	54_M	0.672	0.13
20_R	40_D	0.672	0.13
66_M	102_N	0.669	0.13
36_K	55_C	0.667	0.13
58_G	61_Q	0.666	0.13
71_R	86_P	0.665	0.13
43_H	108_G	0.662	0.13
28_P	110_D	0.657	0.13
31_E	51_Q	0.654	0.13
15_S	29_V	0.653	0.12
95_L	103_I	0.651	0.12
41_S	89_I	0.649	0.12
25_I	29_V	0.647	0.12
84_T	96_V	0.645	0.12
21_G	57_L	0.628	0.12
34_K	75_A	0.621	0.12
86_P	93_K	0.618	0.12
12_T	50_G	0.610	0.12
11_L	90_Q	0.609	0.12
97_A	103_I	0.609	0.12
33_L	40_D	0.608	0.12
21_G	44_Y	0.601	0.12
58_G	75_A	0.600	0.12
28_P	36_K	0.586	0.11
67_N	102_N	0.584	0.11
62_E	100_D	0.579	0.11
79_N	96_V	0.571	0.11
12_T	31_E	0.570	0.11
42_I	97_A	0.569	0.11
95_L	98_G	0.564	0.11
29_V	43_H	0.559	0.11
89_I	93_K	0.556	0.11
62_E	97_A	0.551	0.11
80_N	106_E	0.541	0.11
61_Q	97_A	0.537	0.11
35_L	106_E	0.534	0.11
44_Y	88_N	0.530	0.11
38_G	47_L	0.527	0.10
19_I	40_D	0.524	0.10
13_T	78_Q	0.514	0.10
71_R	96_V	0.510	0.10
62_E	92_G	0.500	0.10

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2l66A	2	0.4685	98.1	0.813	Contact Map
2w1tA	2	0.8739	98.1	0.816	Contact Map
1yfbA	2	0.4685	98	0.82	Contact Map
3o27A	2	0.5045	97.4	0.841	Contact Map
2glwA	1	0.4324	95.1	0.874	Contact Map
1mvfD	1	0.3964	94.4	0.879	Contact Map
2mrnA	2	0.5135	93.7	0.882	Contact Map
2vb2X	1	0.4685	25.8	0.936	Contact Map
2qcpX	1	0.3964	25.1	0.936	Contact Map
4ce4c	1	0.4685	20.5	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.