RIML - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RIML - Ribosomal-protein-serine acetyltransferase

UniProt:	P13857	Sequences: MTETIKVSESLELHAVAENHVKPLYQLICKNKTWLQQSLNWPQFVQSEEDTRKTVQGNVMLHQRGYAKMFMIFKEDELIGVISFNRIEPLNKTAEIGYWLDESHQGQGIISQALQALIHHYAQSGELRRFVIKCRVDNPQSNQVALRNGFILEGCLKQAEFLNDAYDDVNLYARIIDSQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10853
Length:	179 (164)
Sequences:	20074 (15267)
Seq/√Len:	1192.1

ECOLI - RIML RIMJ ATDA YHHY MNAT
BACSU - YOAA YOKL YDAF YJCK YNAD YKKB YJDG YWNH
HALSA - Q9HNJ3 Q9HMZ2 Q9HRY6 Q9HRY5 Q9HSL3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
132_I	145_A	2.749	1.00
111_S	147_R	2.711	1.00
14_H	73_F	2.646	1.00
14_H	20_H	2.449	1.00
34_W	102_E	2.389	1.00
153_E	173_A	2.301	1.00
94_A	127_L	2.190	1.00
10_S	112_Q	2.154	1.00
134_C	142_N	2.130	1.00
84_F	121_Y	2.118	1.00
7_V	75_E	2.100	1.00
152_L	155_C	2.069	1.00
134_C	145_A	2.027	1.00
8_S	116_A	2.007	1.00
152_L	170_N	1.972	1.00
143_Q	146_L	1.953	1.00
8_S	112_Q	1.937	1.00
142_N	146_L	1.866	1.00
119_H	123_Q	1.845	1.00
22_K	48_E	1.775	1.00
96_I	114_L	1.745	1.00
71_M	78_L	1.725	1.00
128_R	158_Q	1.723	1.00
118_I	130_F	1.717	1.00
118_I	150_F	1.716	1.00
16_V	71_M	1.683	1.00
30_K	102_E	1.640	1.00
155_C	170_N	1.633	1.00
23_P	78_L	1.588	1.00
101_D	104_H	1.571	1.00
114_L	148_N	1.551	1.00
82_I	113_A	1.540	1.00
21_V	52_R	1.529	1.00
142_N	152_L	1.523	1.00
48_E	52_R	1.517	1.00
73_F	76_D	1.511	1.00
116_A	119_H	1.500	1.00
47_S	50_D	1.498	1.00
136_V	168_D	1.473	1.00
12_E	75_E	1.434	1.00
54_T	58_N	1.426	1.00
161_F	166_Y	1.425	1.00
142_N	170_N	1.405	1.00
146_L	152_L	1.398	1.00
18_E	56_Q	1.376	1.00
100_L	110_I	1.369	1.00
74_K	79_I	1.359	1.00
139_P	142_N	1.338	1.00
6_K	116_A	1.325	1.00
98_Y	145_A	1.322	1.00
128_R	166_Y	1.306	1.00
111_S	144_V	1.305	1.00
7_V	12_E	1.282	1.00
72_I	113_A	1.274	1.00
82_I	117_L	1.248	1.00
79_I	104_H	1.233	1.00
72_I	100_L	1.230	1.00
23_P	77_E	1.223	1.00
12_E	73_F	1.210	1.00
120_H	124_S	1.207	1.00
74_K	109_I	1.203	1.00
142_N	172_Y	1.201	1.00
136_V	155_C	1.198	1.00
21_V	55_V	1.194	1.00
159_A	169_V	1.186	1.00
121_Y	130_F	1.176	1.00
77_E	103_S	1.151	1.00
156_L	171_L	1.130	1.00
137_D	167_D	1.123	1.00
129_R	173_A	1.123	1.00
25_Y	48_E	1.109	1.00
121_Y	125_G	1.084	1.00
110_I	144_V	1.082	1.00
98_Y	141_S	1.080	1.00
77_E	104_H	1.077	1.00
52_R	56_Q	1.064	1.00
34_W	105_Q	1.058	1.00
129_R	153_E	1.053	1.00
27_L	101_D	1.049	1.00
157_K	173_A	1.044	1.00
6_K	13_L	1.041	1.00
81_V	99_W	1.041	1.00
21_V	48_E	1.039	1.00
8_S	11_L	1.039	1.00
105_Q	140_Q	1.035	1.00
18_E	52_R	1.033	1.00
102_E	105_Q	1.031	1.00
88_E	91_N	1.026	1.00
95_E	133_K	1.015	1.00
34_W	37_Q	1.009	1.00
158_Q	168_D	1.005	1.00
6_K	120_H	0.994	1.00
23_P	26_Q	0.990	1.00
93_T	131_V	0.980	1.00
70_F	120_H	0.979	1.00
70_F	117_L	0.977	1.00
132_I	150_F	0.977	1.00
141_S	145_A	0.976	1.00
144_V	148_N	0.966	1.00
60_M	64_R	0.965	1.00
46_Q	50_D	0.963	1.00
155_C	168_D	0.962	1.00
27_L	99_W	0.959	1.00
111_S	115_Q	0.957	1.00
134_C	172_Y	0.957	1.00
145_A	150_F	0.943	1.00
120_H	125_G	0.937	1.00
152_L	172_Y	0.933	1.00
45_V	51_T	0.926	1.00
25_Y	29_C	0.923	1.00
30_K	34_W	0.915	1.00
118_I	148_N	0.910	1.00
53_K	57_G	0.907	1.00
74_K	107_Q	0.904	1.00
30_K	101_D	0.898	1.00
157_K	168_D	0.897	1.00
106_G	140_Q	0.876	1.00
30_K	103_S	0.875	1.00
135_R	167_D	0.873	1.00
139_P	143_Q	0.872	1.00
73_F	78_L	0.867	1.00
84_F	117_L	0.864	1.00
35_L	105_Q	0.863	1.00
18_E	59_V	0.858	1.00
98_Y	110_I	0.858	1.00
121_Y	127_L	0.857	1.00
74_K	77_E	0.851	1.00
77_E	101_D	0.850	1.00
26_Q	101_D	0.849	1.00
115_Q	119_H	0.847	1.00
93_T	129_R	0.847	1.00
111_S	148_N	0.846	1.00
12_E	76_D	0.834	1.00
112_Q	116_A	0.833	1.00
20_H	73_F	0.825	1.00
16_V	81_V	0.822	1.00
92_K	166_Y	0.813	1.00
11_L	109_I	0.808	1.00
153_E	157_K	0.802	1.00
136_V	170_N	0.799	1.00
38_S	135_R	0.798	1.00
100_L	109_I	0.792	1.00
49_E	52_R	0.792	1.00
22_K	26_Q	0.789	1.00
18_E	21_V	0.789	1.00
11_L	113_A	0.786	1.00
115_Q	148_N	0.786	1.00
26_Q	77_E	0.785	1.00
21_V	25_Y	0.775	1.00
93_T	159_A	0.768	1.00
28_I	99_W	0.768	1.00
74_K	104_H	0.761	1.00
139_P	146_L	0.752	1.00
156_L	159_A	0.751	1.00
146_L	172_Y	0.747	1.00
25_Y	51_T	0.741	1.00
104_H	107_Q	0.736	1.00
14_H	71_M	0.735	1.00
92_K	161_F	0.727	1.00
50_D	53_K	0.727	1.00
15_A	62_H	0.717	1.00
26_Q	30_K	0.714	1.00
158_Q	166_Y	0.709	1.00
95_E	131_V	0.708	1.00
134_C	141_S	0.704	1.00
56_Q	60_M	0.704	1.00
53_K	56_Q	0.699	1.00
114_L	144_V	0.699	1.00
161_F	165_A	0.697	1.00
49_E	53_K	0.696	1.00
23_P	101_D	0.695	1.00
132_I	141_S	0.693	1.00
38_S	137_D	0.685	1.00
106_G	111_S	0.683	1.00
26_Q	103_S	0.680	1.00
8_S	13_L	0.678	1.00
98_Y	114_L	0.675	1.00
133_K	156_L	0.674	1.00
9_E	112_Q	0.666	1.00
110_I	114_L	0.666	1.00
10_S	108_G	0.664	1.00
143_Q	147_R	0.661	1.00
109_I	112_Q	0.652	1.00
69_M	83_S	0.651	1.00
27_L	78_L	0.648	1.00
111_S	140_Q	0.645	1.00
134_C	170_N	0.642	1.00
72_I	109_I	0.637	1.00
106_G	143_Q	0.633	1.00
79_I	109_I	0.632	1.00
94_A	121_Y	0.631	1.00
36_Q	39_L	0.630	1.00
72_I	82_I	0.630	1.00
140_Q	143_Q	0.625	1.00
133_K	169_V	0.619	1.00
137_D	165_A	0.618	1.00
58_N	69_M	0.615	1.00
72_I	80_G	0.614	1.00
84_F	94_A	0.610	1.00
51_T	55_V	0.605	1.00
98_Y	144_V	0.599	1.00
151_I	157_K	0.597	1.00
100_L	104_H	0.590	1.00
46_Q	51_T	0.588	1.00
92_K	128_R	0.582	1.00
154_G	173_A	0.580	1.00
136_V	142_N	0.579	1.00
82_I	114_L	0.574	1.00
100_L	105_Q	0.574	1.00
106_G	144_V	0.573	1.00
162_L	167_D	0.571	1.00
10_S	75_E	0.569	1.00
35_L	99_W	0.566	1.00
78_L	81_V	0.561	1.00
23_P	73_F	0.560	1.00
57_G	60_M	0.557	1.00
11_L	112_Q	0.556	1.00
162_L	165_A	0.555	1.00
17_A	20_H	0.552	1.00
30_K	105_Q	0.544	1.00
39_L	99_W	0.544	1.00
161_F	164_D	0.543	1.00
14_H	17_A	0.542	1.00
62_H	68_K	0.538	1.00
118_I	122_A	0.538	1.00
129_R	159_A	0.537	1.00
36_Q	43_Q	0.536	1.00
114_L	150_F	0.536	1.00
160_E	169_V	0.530	1.00
131_V	156_L	0.530	1.00
15_A	59_V	0.530	1.00
22_K	25_Y	0.529	1.00
132_I	172_Y	0.527	1.00
145_A	172_Y	0.526	1.00
67_A	83_S	0.524	1.00
133_K	171_L	0.520	1.00
55_V	59_V	0.518	1.00
131_V	159_A	0.516	1.00
94_A	130_F	0.515	1.00
36_Q	41_W	0.514	1.00
16_V	24_L	0.509	1.00
154_G	157_K	0.509	1.00
83_S	97_G	0.503	1.00
15_A	63_Q	0.502	1.00
72_I	110_I	0.502	1.00
59_V	62_H	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3r9fA	1	0.9832	100	0.272	Contact Map
1s7kA	2	0.8827	100	0.294	Contact Map
2fckA	2	0.9553	100	0.299	Contact Map
2vzyA	3	0.8883	100	0.304	Contact Map
3pzjA	2	0.9665	100	0.306	Contact Map
1nslA	3	0.9944	100	0.307	Contact Map
1yreA	2	0.9385	100	0.308	Contact Map
2z10A	2	0.9665	100	0.309	Contact Map
3fbuA	2	0.9218	100	0.335	Contact Map
3igrA	2	0.9888	100	0.347	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.