INSC4 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

INSC4 - Transposase InsC for insertion element IS2H

UniProt:	P0CF43	Sequences: MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVEYGRAKKWIAHAPLLPGDGE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG40003
Length:	121 (113)
Sequences:	115 (70)
Seq/√Len:	6.5

ECOLI - INSC1 INSC2 INSC3 INSC4 INSC5 INSC6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
110_I	114_P	2.542	0.68
109_W	114_P	2.151	0.55
76_A	80_I	2.114	0.54
65_E	71_S	2.100	0.53
84_Q	89_K	2.039	0.51
14_T	17_E	2.023	0.50
91_T	96_L	2.004	0.49
73_L	76_A	1.996	0.49
76_A	111_A	1.967	0.48
110_I	115_L	1.949	0.47
60_A	67_V	1.928	0.47
96_L	100_A	1.903	0.46
95_E	100_A	1.845	0.44
53_Y	57_S	1.820	0.43
94_N	101_V	1.762	0.41
26_F	57_S	1.669	0.37
95_E	99_E	1.627	0.36
65_E	69_P	1.545	0.33
14_T	72_E	1.533	0.33
25_S	50_R	1.530	0.33
91_T	100_A	1.501	0.32
44_S	50_R	1.467	0.31
79_Q	84_Q	1.436	0.30
30_M	38_Q	1.423	0.29
61_V	74_A	1.415	0.29
47_F	70_A	1.414	0.29
79_Q	89_K	1.352	0.27
91_T	99_E	1.344	0.27
43_A	59_T	1.322	0.26
23_Q	52_Q	1.317	0.26
38_Q	106_A	1.314	0.26
8_E	20_A	1.298	0.26
91_T	95_E	1.265	0.25
25_S	38_Q	1.263	0.25
7_P	45_Q	1.263	0.25
26_F	50_R	1.255	0.24
109_W	115_L	1.252	0.24
109_W	116_L	1.246	0.24
96_L	99_E	1.242	0.24
37_R	56_G	1.226	0.24
82_E	89_K	1.226	0.24
107_K	112_H	1.220	0.23
111_A	115_L	1.212	0.23
21_I	42_A	1.211	0.23
31_T	80_I	1.209	0.23
64_G	76_A	1.184	0.22
97_L	100_A	1.175	0.22
7_P	20_A	1.170	0.22
51_K	77_M	1.170	0.22
8_E	12_R	1.168	0.22
91_T	97_L	1.145	0.21
25_S	31_T	1.135	0.21
93_E	100_A	1.134	0.21
55_E	66_Q	1.119	0.21
23_Q	62_A	1.107	0.21
109_W	113_A	1.102	0.20
32_V	68_V	1.096	0.20
112_H	116_L	1.091	0.20
33_S	87_L	1.077	0.20
93_E	97_L	1.073	0.20
19_I	52_Q	1.073	0.20
13_R	45_Q	1.043	0.19
111_A	114_P	1.033	0.19
36_A	87_L	1.030	0.19
56_G	83_L	1.028	0.19
21_I	103_Y	1.026	0.19
4_V	20_A	1.008	0.18
11_R	22_V	1.007	0.18
92_M	99_E	1.001	0.18
53_Y	61_V	0.995	0.18
37_R	49_W	0.994	0.18
45_Q	48_L	0.987	0.18
58_L	69_P	0.980	0.18
82_E	85_R	0.956	0.17
54_Q	92_M	0.950	0.17
80_I	92_M	0.938	0.17
20_A	84_Q	0.931	0.17
34_L	38_Q	0.926	0.17
101_V	104_G	0.926	0.17
30_M	44_S	0.915	0.16
106_A	110_I	0.913	0.16
105_R	114_P	0.907	0.16
37_R	83_L	0.896	0.16
110_I	116_L	0.896	0.16
57_S	69_P	0.894	0.16
22_V	34_L	0.890	0.16
24_Q	43_A	0.888	0.16
73_L	80_I	0.868	0.15
7_P	31_T	0.862	0.15
23_Q	73_L	0.861	0.15
26_F	41_V	0.861	0.15
93_E	96_L	0.849	0.15
33_S	49_W	0.848	0.15
69_P	84_Q	0.837	0.15
29_G	32_V	0.834	0.15
11_R	40_G	0.829	0.15
10_R	18_K	0.828	0.15
55_E	61_V	0.825	0.15
23_Q	77_M	0.824	0.15
64_G	79_Q	0.818	0.14
11_R	107_K	0.808	0.14
74_A	77_M	0.807	0.14
70_A	89_K	0.806	0.14
40_G	61_V	0.799	0.14
96_L	102_E	0.794	0.14
23_Q	81_K	0.793	0.14
6_G	25_S	0.785	0.14
52_Q	60_A	0.784	0.14
4_V	51_K	0.782	0.14
27_E	109_W	0.774	0.14
27_E	50_R	0.764	0.13
37_R	100_A	0.741	0.13
41_V	47_F	0.738	0.13
13_R	46_L	0.732	0.13
41_V	114_P	0.732	0.13
19_I	75_A	0.730	0.13
30_M	42_A	0.728	0.13
12_R	47_F	0.727	0.13
33_S	36_A	0.720	0.13
73_L	84_Q	0.713	0.13
68_V	71_S	0.709	0.13
82_E	86_L	0.708	0.13
13_R	31_T	0.700	0.12
4_V	7_P	0.688	0.12
26_F	78_K	0.685	0.12
101_V	114_P	0.677	0.12
77_M	107_K	0.675	0.12
91_T	102_E	0.672	0.12
39_H	98_K	0.666	0.12
54_Q	66_Q	0.666	0.12
27_E	73_L	0.663	0.12
86_L	92_M	0.657	0.12
44_S	85_R	0.653	0.12
68_V	92_M	0.652	0.12
23_Q	55_E	0.652	0.12
113_A	116_L	0.650	0.12
57_S	64_G	0.646	0.12
23_Q	27_E	0.644	0.12
8_E	14_T	0.643	0.12
56_G	71_S	0.627	0.11
5_L	98_K	0.627	0.11
63_A	92_M	0.605	0.11
92_M	97_L	0.604	0.11
74_A	80_I	0.600	0.11
19_I	82_E	0.593	0.11
109_W	112_H	0.593	0.11
31_T	39_H	0.592	0.11
41_V	107_K	0.589	0.11
36_A	46_L	0.587	0.11
48_L	81_K	0.586	0.11
24_Q	99_E	0.576	0.11
39_H	58_L	0.576	0.11
52_Q	104_G	0.569	0.10
108_K	115_L	0.559	0.10
26_F	86_L	0.558	0.10
83_L	100_A	0.556	0.10
42_A	73_L	0.551	0.10
40_G	108_K	0.545	0.10
57_S	65_E	0.545	0.10
34_L	75_A	0.543	0.10
65_E	116_L	0.541	0.10
99_E	105_R	0.539	0.10
77_M	80_I	0.526	0.10
64_G	84_Q	0.525	0.10
42_A	81_K	0.524	0.10
57_S	77_M	0.514	0.10
24_Q	52_Q	0.513	0.10
57_S	101_V	0.508	0.10
53_Y	76_A	0.504	0.10
22_V	102_E	0.500	0.10

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2jrtA	1	0.6198	99.6	0.723	Contact Map
2oa4A	1	0.6612	99.5	0.726	Contact Map
2rn7A	1	0.8347	99.3	0.76	Contact Map
2jn6A	1	0.7934	98.8	0.804	Contact Map
2elhA	1	0.6364	98	0.845	Contact Map
2gloA	1	0.4628	97.9	0.851	Contact Map
1hlvA	1	0.9256	97.6	0.859	Contact Map
2ao9A	7	0.7521	97.3	0.867	Contact Map
4dyqA	5	0.8017	96.5	0.88	Contact Map
1k78A	1	0.9256	96.5	0.881	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.