INSB6 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

INSB6 - Insertion element IS1 6 protein InsB

UniProt:	P0CF29	Sequences: MPGNSPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVGAKSRQRWLFYAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG40002
Length:	167 (134)
Sequences:	188 (147)
Seq/√Len:	12.7

ECOLI - INSB1 INSB5 INSB6 INSB4 INSB2 INSB3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_E	65_S	3.332	0.98
134_Q	144_L	3.178	0.97
65_S	124_R	3.022	0.96
137_A	144_L	2.938	0.96
135_H	160_Y	2.682	0.93
149_S	152_L	2.521	0.91
49_Y	88_S	2.351	0.87
48_G	153_H	2.330	0.87
134_Q	137_A	2.175	0.83
98_W	110_L	2.111	0.81
58_W	62_A	1.943	0.75
49_Y	85_R	1.890	0.72
127_R	131_N	1.860	0.71
57_R	154_D	1.775	0.67
58_W	86_L	1.718	0.65
134_Q	145_S	1.679	0.63
127_R	130_L	1.675	0.63
43_M	100_T	1.670	0.63
61_Y	129_N	1.607	0.59
74_V	82_T	1.604	0.59
125_I	139_L	1.592	0.59
80_M	108_S	1.579	0.58
48_G	127_R	1.573	0.58
130_L	144_L	1.561	0.57
63_Y	128_H	1.540	0.56
139_L	144_L	1.536	0.56
49_Y	66_L	1.524	0.55
49_Y	60_F	1.506	0.54
105_L	118_S	1.506	0.54
122_T	138_R	1.469	0.52
157_I	161_L	1.429	0.50
128_H	134_Q	1.411	0.49
50_V	153_H	1.401	0.49
46_Q	59_L	1.385	0.48
68_K	128_H	1.383	0.48
83_L	109_R	1.372	0.47
63_Y	68_K	1.356	0.47
65_S	159_H	1.356	0.47
58_W	143_S	1.338	0.46
161_L	166_Y	1.327	0.45
42_E	124_R	1.324	0.45
72_A	86_L	1.323	0.45
130_L	140_G	1.318	0.45
130_L	134_Q	1.285	0.43
61_Y	115_H	1.265	0.42
33_P	36_D	1.261	0.42
61_Y	155_K	1.212	0.39
125_I	159_H	1.201	0.39
97_I	116_V	1.188	0.38
64_D	145_S	1.162	0.37
44_D	138_R	1.146	0.36
101_D	126_E	1.142	0.36
130_L	137_A	1.133	0.36
140_G	146_F	1.131	0.35
137_A	145_S	1.128	0.35
47_W	122_T	1.091	0.34
74_V	150_V	1.076	0.33
39_V	49_Y	1.076	0.33
128_H	136_L	1.070	0.33
134_Q	140_G	1.068	0.33
59_L	93_F	1.060	0.32
106_Y	126_E	1.057	0.32
131_N	160_Y	1.050	0.32
66_L	161_L	1.049	0.32
146_F	153_H	1.047	0.32
57_R	150_V	1.045	0.31
80_M	84_G	1.041	0.31
131_N	135_H	1.031	0.31
146_F	166_Y	1.029	0.31
50_V	147_S	1.029	0.31
63_Y	67_R	1.014	0.30
87_M	162_N	1.011	0.30
139_L	157_I	1.004	0.30
136_L	149_S	0.993	0.29
43_M	161_L	0.986	0.29
57_R	70_V	0.975	0.28
59_L	75_F	0.973	0.28
70_V	143_S	0.971	0.28
158_G	163_I	0.970	0.28
67_R	92_P	0.961	0.28
126_E	133_R	0.955	0.28
47_W	146_F	0.944	0.27
50_V	117_I	0.938	0.27
111_K	117_I	0.929	0.27
47_W	164_K	0.925	0.26
47_W	86_L	0.910	0.26
63_Y	100_T	0.909	0.26
63_Y	82_T	0.908	0.26
62_A	70_V	0.907	0.26
42_E	103_W	0.905	0.26
74_V	86_L	0.903	0.26
128_H	144_L	0.899	0.25
34_G	37_V	0.897	0.25
89_L	93_F	0.887	0.25
135_H	153_H	0.880	0.25
80_M	145_S	0.872	0.24
40_C	121_Y	0.859	0.24
93_F	123_Q	0.856	0.24
59_L	158_G	0.856	0.24
43_M	120_R	0.851	0.24
91_S	96_V	0.832	0.23
52_A	64_D	0.829	0.23
42_E	122_T	0.824	0.23
147_S	153_H	0.815	0.22
73_H	159_H	0.812	0.22
93_F	158_G	0.806	0.22
92_P	108_S	0.794	0.21
84_G	108_S	0.790	0.21
137_A	140_G	0.785	0.21
37_V	125_I	0.781	0.21
92_P	125_I	0.766	0.21
42_E	64_D	0.762	0.20
82_T	157_I	0.761	0.20
95_V	130_L	0.754	0.20
38_I	73_H	0.753	0.20
67_R	165_H	0.752	0.20
80_M	104_P	0.736	0.20
99_M	151_E	0.734	0.19
121_Y	142_K	0.732	0.19
80_M	166_Y	0.730	0.19
62_A	147_S	0.729	0.19
77_E	82_T	0.727	0.19
63_Y	165_H	0.724	0.19
134_Q	139_L	0.719	0.19
108_S	166_Y	0.717	0.19
123_Q	127_R	0.709	0.19
57_R	110_L	0.708	0.19
81_A	111_K	0.706	0.19
106_Y	143_S	0.705	0.19
59_L	157_I	0.701	0.18
52_A	77_E	0.701	0.18
64_D	146_F	0.691	0.18
90_L	156_V	0.686	0.18
84_G	117_I	0.683	0.18
51_G	81_A	0.683	0.18
88_S	100_T	0.682	0.18
160_Y	164_K	0.680	0.18
45_E	53_K	0.678	0.18
63_Y	124_R	0.677	0.18
75_F	78_R	0.676	0.18
50_V	57_R	0.675	0.18
149_S	156_V	0.674	0.18
86_L	142_K	0.674	0.18
140_G	166_Y	0.673	0.18
152_L	156_V	0.672	0.18
56_Q	89_L	0.669	0.17
47_W	78_R	0.669	0.17
70_V	131_N	0.669	0.17
79_T	87_M	0.669	0.17
46_Q	123_Q	0.668	0.17
49_Y	74_V	0.665	0.17
100_T	125_I	0.661	0.17
132_L	136_L	0.656	0.17
110_L	113_K	0.652	0.17
101_D	106_Y	0.649	0.17
58_W	105_L	0.645	0.17
138_R	147_S	0.641	0.17
52_A	98_W	0.639	0.17
128_H	166_Y	0.634	0.16
51_G	71_V	0.633	0.16
50_V	103_W	0.624	0.16
43_M	152_L	0.623	0.16
43_M	163_I	0.621	0.16
110_L	154_D	0.617	0.16
101_D	138_R	0.615	0.16
98_W	150_V	0.614	0.16
61_Y	125_I	0.610	0.16
99_M	136_L	0.609	0.16
41_A	165_H	0.608	0.16
51_G	151_E	0.606	0.16
38_I	102_G	0.601	0.16
66_L	151_E	0.598	0.15
50_V	100_T	0.596	0.15
160_Y	163_I	0.592	0.15
41_A	64_D	0.586	0.15
46_Q	132_L	0.581	0.15
90_L	137_A	0.578	0.15
60_F	133_R	0.577	0.15
50_V	135_H	0.575	0.15
85_R	105_L	0.565	0.15
83_L	165_H	0.563	0.15
70_V	76_G	0.562	0.14
54_S	88_S	0.562	0.14
81_A	84_G	0.560	0.14
54_S	85_R	0.552	0.14
123_Q	158_G	0.549	0.14
125_I	153_H	0.549	0.14
116_V	121_Y	0.545	0.14
153_H	158_G	0.541	0.14
77_E	81_A	0.538	0.14
48_G	131_N	0.532	0.14
118_S	157_I	0.528	0.14
71_V	85_R	0.526	0.14
40_C	151_E	0.518	0.13
53_K	106_Y	0.517	0.13
40_C	103_W	0.516	0.13
131_N	164_K	0.514	0.13
46_Q	75_F	0.513	0.13
127_R	164_K	0.504	0.13
63_Y	164_K	0.504	0.13
62_A	138_R	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4fcyA	4	0.976	97.5	0.87	Contact Map
4fw1A	2	0.8024	97.5	0.871	Contact Map
1bcoA	1	0.8024	97.5	0.871	Contact Map
3l3uA	2	0.7066	97.4	0.874	Contact Map
4mq3A	1	0.7006	97.2	0.877	Contact Map
1cxqA	2	0.7665	97.2	0.878	Contact Map
1c6vA	4	0.6647	97	0.881	Contact Map
4cf8A	2	0.7066	97	0.882	Contact Map
2x78A	2	0.7365	96.8	0.884	Contact Map
4pa1A	2	0.7066	96.6	0.886	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.