INSA2 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

INSA2 - Insertion element IS1 2 protein InsA

UniProt:	P0CF08	Sequences: MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTYTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTIFRHLKNSGRSR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG40001
Length:	91 (73)
Sequences:	360 (324)
Seq/√Len:	37.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_C	11_C	7.553	1.00
7_S	11_C	5.026	1.00
20_N	24_T	3.263	1.00
14_T	42_Q	3.112	1.00
6_I	11_C	2.261	0.99
59_M	62_N	2.063	0.99
46_T	49_Q	1.755	0.97
21_G	36_R	1.724	0.97
35_C	48_S	1.642	0.95
19_R	22_K	1.568	0.94
48_S	52_T	1.551	0.94
57_I	62_N	1.450	0.91
74_G	78_N	1.377	0.89
21_G	49_Q	1.364	0.88
20_N	35_C	1.337	0.87
7_S	12_S	1.313	0.86
32_C	48_S	1.290	0.85
74_G	77_L	1.281	0.85
30_Y	46_T	1.263	0.84
37_K	50_P	1.228	0.82
63_G	66_C	1.203	0.81
62_N	66_C	1.197	0.81
58_D	71_R	1.195	0.81
43_F	47_A	1.162	0.79
20_N	32_C	1.112	0.76
24_T	35_C	1.106	0.75
26_G	29_R	1.072	0.73
32_C	52_T	1.065	0.72
60_A	76_G	1.033	0.70
45_Y	48_S	1.024	0.69
27_H	43_F	1.010	0.68
22_K	27_H	0.999	0.67
14_T	68_A	0.986	0.66
62_N	75_V	0.962	0.65
64_V	68_A	0.934	0.62
19_R	30_Y	0.929	0.62
38_T	58_D	0.916	0.61
31_L	38_T	0.913	0.60
57_I	66_C	0.906	0.60
24_T	29_R	0.904	0.60
30_Y	38_T	0.903	0.60
62_N	65_G	0.897	0.59
65_G	70_A	0.897	0.59
69_T	72_I	0.892	0.59
9_P	12_S	0.884	0.58
31_L	36_R	0.881	0.58
26_G	40_Q	0.877	0.57
42_Q	46_T	0.857	0.56
59_M	66_C	0.820	0.52
7_S	10_S	0.817	0.52
9_P	13_A	0.812	0.52
33_S	60_A	0.806	0.51
72_I	76_G	0.797	0.50
33_S	69_T	0.793	0.50
33_S	39_W	0.791	0.50
67_R	70_A	0.779	0.49
73_M	77_L	0.772	0.48
56_I	65_G	0.743	0.45
72_I	75_V	0.731	0.44
23_S	44_T	0.728	0.44
37_K	56_I	0.727	0.44
22_K	26_G	0.720	0.43
66_C	75_V	0.719	0.43
25_A	53_H	0.701	0.42
63_G	76_G	0.674	0.39
30_Y	51_G	0.673	0.39
55_K	61_M	0.671	0.39
41_L	46_T	0.662	0.38
15_D	44_T	0.662	0.38
40_Q	54_Q	0.660	0.38
28_Q	31_L	0.652	0.38
66_C	71_R	0.647	0.37
53_H	71_R	0.646	0.37
8_C	12_S	0.643	0.37
6_I	10_S	0.643	0.37
70_A	78_N	0.621	0.35
66_C	78_N	0.613	0.34
6_I	9_P	0.610	0.34
64_V	75_V	0.609	0.34
38_T	64_V	0.604	0.34
19_R	44_T	0.600	0.33
53_H	58_D	0.600	0.33
41_L	47_A	0.598	0.33
17_V	26_G	0.590	0.32
38_T	55_K	0.587	0.32
46_T	50_P	0.586	0.32
16_G	44_T	0.574	0.31
19_R	25_A	0.572	0.31
17_V	20_N	0.565	0.31
28_Q	54_Q	0.565	0.31
72_I	77_L	0.548	0.29
13_A	27_H	0.546	0.29
22_K	29_R	0.546	0.29
6_I	21_G	0.541	0.29
44_T	47_A	0.540	0.29
39_W	52_T	0.540	0.29
28_Q	34_H	0.531	0.28
70_A	74_G	0.528	0.28
11_C	20_N	0.527	0.28
14_T	32_C	0.527	0.28
24_T	27_H	0.525	0.28
15_D	40_Q	0.515	0.27
25_A	29_R	0.513	0.27
34_H	69_T	0.512	0.27
16_G	42_Q	0.512	0.27
18_V	44_T	0.508	0.26
24_T	48_S	0.507	0.26
63_G	67_R	0.506	0.26
20_N	29_R	0.506	0.26
55_K	65_G	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3w5kB	1	0.9121	99.2	0.423	Contact Map
2m9aA	1	0.9121	99.1	0.432	Contact Map
2i13A	1	0.8681	99.1	0.435	Contact Map
2rsjA	1	0.9231	99.1	0.441	Contact Map
1ej6B	7	0.8242	99.1	0.445	Contact Map
2dmdA	1	0.967	99.1	0.449	Contact Map
4x9jA	1	0.8681	99	0.455	Contact Map
2ee8A	1	0.978	99	0.458	Contact Map
2ma7A	1	0.6484	99	0.461	Contact Map
2jp9A	1	0.8681	99	0.462	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.