SODC - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SODC - Superoxide dismutase [Cu-Zn]

UniProt:	P0AGD1	Sequences: MKRFSLAILALVVATGAQAASEKVEMNLVTSQGVGQSIGSVTITETDKGLEFSPDLKALPPGEHGFHIHAKGSCQPATKDGKASAAESAGGHLDPQNTGKHEGPEGAGHLGDLPALVVNNDGKATDAVIAPRLKSLDEIKDKALMVHVGGDNMSDQPKPLGGGGERYACGVIK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13419
Length:	173 (141)
Sequences:	2330 (1543)
Seq/√Len:	129.9

ECOLI - SODC
BACSU - YOJM

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
119_N	123_K	3.052	1.00
54_P	126_D	2.998	1.00
148_V	165_E	2.970	1.00
63_E	117_V	2.911	1.00
55_D	125_T	2.876	1.00
43_I	144_L	2.666	1.00
41_V	54_P	2.434	1.00
60_P	167_Y	2.296	1.00
135_S	138_E	2.290	1.00
98_T	107_A	2.282	1.00
63_E	150_G	2.207	1.00
51_E	127_A	2.154	1.00
50_L	134_K	2.138	1.00
62_G	118_V	2.045	1.00
154_S	157_P	1.859	1.00
139_I	142_K	1.856	1.00
155_D	160_L	1.811	1.00
89_A	143_A	1.761	1.00
156_Q	162_G	1.752	1.00
67_H	92_H	1.695	1.00
43_I	52_F	1.690	1.00
64_H	118_V	1.685	1.00
115_A	153_M	1.662	1.00
72_G	171_V	1.649	1.00
41_V	144_L	1.631	1.00
138_E	142_K	1.592	1.00
51_E	129_I	1.573	1.00
43_I	139_I	1.568	1.00
73_S	88_S	1.562	1.00
92_H	109_H	1.541	1.00
57_K	123_K	1.527	1.00
154_S	162_G	1.519	1.00
44_T	53_S	1.509	1.00
102_E	153_M	1.464	1.00
74_C	143_A	1.460	1.00
53_S	127_A	1.452	1.00
75_Q	88_S	1.407	1.00
113_L	130_A	1.406	1.00
54_P	127_A	1.401	1.00
68_I	172_I	1.381	1.00
118_V	124_A	1.346	1.00
93_L	110_L	1.343	1.00
74_C	169_C	1.291	1.00
65_G	163_G	1.263	1.00
108_G	130_A	1.263	1.00
68_I	144_L	1.252	1.00
99_G	107_A	1.245	1.00
56_L	116_L	1.232	1.00
70_A	91_G	1.224	1.00
59_L	124_A	1.209	0.99
50_L	133_L	1.191	0.99
76_P	87_E	1.187	0.99
95_P	110_L	1.183	0.99
86_A	169_C	1.154	0.99
61_P	122_G	1.149	0.99
45_E	50_L	1.145	0.99
60_P	64_H	1.137	0.99
52_F	128_V	1.134	0.99
24_V	28_L	1.132	0.99
49_G	129_I	1.129	0.99
94_D	98_T	1.091	0.99
89_A	166_R	1.090	0.99
65_G	116_L	1.084	0.99
61_P	120_N	1.084	0.99
101_H	105_E	1.084	0.99
68_I	133_L	1.076	0.99
69_H	92_H	1.076	0.99
54_P	66_F	1.063	0.99
41_V	52_F	1.054	0.99
43_I	172_I	1.046	0.98
160_L	163_G	1.044	0.98
100_K	109_H	1.040	0.98
93_L	142_K	1.032	0.98
93_L	135_S	1.026	0.98
54_P	124_A	1.023	0.98
38_I	58_A	0.995	0.98
56_L	124_A	0.994	0.98
152_N	155_D	0.991	0.98
38_I	168_A	0.984	0.98
41_V	126_D	0.966	0.97
102_E	105_E	0.957	0.97
130_A	133_L	0.951	0.97
59_L	146_V	0.949	0.97
72_G	143_A	0.944	0.97
67_H	147_H	0.940	0.97
46_T	51_E	0.936	0.97
77_A	87_E	0.932	0.97
101_H	108_G	0.931	0.97
26_M	170_G	0.914	0.96
115_A	152_N	0.913	0.96
26_M	30_T	0.904	0.96
93_L	138_E	0.903	0.96
151_D	161_G	0.900	0.96
69_H	147_H	0.894	0.96
32_Q	38_I	0.894	0.96
113_L	133_L	0.889	0.96
96_Q	110_L	0.888	0.96
100_K	103_G	0.886	0.96
40_S	55_D	0.875	0.95
152_N	161_G	0.869	0.95
161_G	164_G	0.868	0.95
149_G	162_G	0.866	0.95
152_N	162_G	0.853	0.95
86_A	157_P	0.848	0.95
101_H	104_P	0.842	0.94
74_C	89_A	0.837	0.94
149_G	167_Y	0.823	0.94
96_Q	148_V	0.820	0.94
147_H	166_R	0.819	0.94
77_A	88_S	0.814	0.93
39_G	56_L	0.808	0.93
71_K	90_G	0.790	0.92
71_K	143_A	0.788	0.92
116_L	124_A	0.776	0.92
166_R	169_C	0.773	0.91
160_L	165_E	0.772	0.91
155_D	163_G	0.771	0.91
94_D	97_N	0.771	0.91
109_H	151_D	0.770	0.91
86_A	145_M	0.769	0.91
147_H	163_G	0.764	0.91
89_A	145_M	0.754	0.90
25_E	29_V	0.751	0.90
71_K	142_K	0.740	0.90
26_M	32_Q	0.738	0.89
114_P	153_M	0.738	0.89
153_M	156_Q	0.734	0.89
53_S	125_T	0.734	0.89
110_L	132_R	0.726	0.89
151_D	164_G	0.717	0.88
76_P	86_A	0.716	0.88
148_V	167_Y	0.712	0.88
70_A	97_N	0.711	0.88
92_H	147_H	0.701	0.87
58_A	122_G	0.691	0.86
45_E	48_K	0.690	0.86
69_H	166_R	0.688	0.86
66_F	116_L	0.687	0.86
134_K	138_E	0.685	0.86
67_H	166_R	0.684	0.86
100_K	104_P	0.676	0.85
60_P	118_V	0.664	0.84
100_K	105_E	0.661	0.84
100_K	152_N	0.658	0.83
126_D	153_M	0.651	0.83
38_I	57_K	0.645	0.82
62_G	117_V	0.641	0.82
135_S	139_I	0.635	0.81
70_A	143_A	0.629	0.81
33_G	36_Q	0.627	0.80
66_F	124_A	0.626	0.80
157_P	161_G	0.625	0.80
30_T	33_G	0.625	0.80
93_L	137_D	0.624	0.80
100_K	161_G	0.624	0.80
72_G	141_D	0.624	0.80
152_N	156_Q	0.621	0.80
67_H	109_H	0.619	0.80
152_N	164_G	0.617	0.79
68_I	130_A	0.614	0.79
56_L	146_V	0.614	0.79
94_D	100_K	0.612	0.79
30_T	56_L	0.611	0.79
48_K	120_N	0.608	0.78
42_T	123_K	0.607	0.78
59_L	62_G	0.602	0.78
28_L	170_G	0.598	0.77
44_T	51_E	0.598	0.77
64_H	167_Y	0.594	0.77
63_E	153_M	0.593	0.77
113_L	116_L	0.590	0.76
108_G	132_R	0.587	0.76
137_D	142_K	0.580	0.75
29_V	34_V	0.579	0.75
96_Q	137_D	0.577	0.75
135_S	140_K	0.572	0.74
61_P	121_D	0.572	0.74
46_T	129_I	0.565	0.73
54_P	128_V	0.564	0.73
109_H	114_P	0.563	0.73
74_C	157_P	0.561	0.73
24_V	27_N	0.560	0.72
94_D	101_H	0.558	0.72
26_M	51_E	0.556	0.72
101_H	161_G	0.550	0.71
109_H	161_G	0.549	0.71
70_A	156_Q	0.543	0.70
119_N	125_T	0.542	0.70
61_P	118_V	0.542	0.70
53_S	126_D	0.538	0.69
28_L	34_V	0.537	0.69
110_L	130_A	0.535	0.69
53_S	57_K	0.534	0.69
50_L	135_S	0.533	0.69
109_H	164_G	0.533	0.69
104_P	107_A	0.529	0.68
74_C	171_V	0.524	0.67
23_K	123_K	0.522	0.67
144_L	170_G	0.521	0.67
28_L	31_S	0.519	0.67
95_P	98_T	0.519	0.67
76_P	88_S	0.518	0.67
47_D	129_I	0.518	0.67
64_H	150_G	0.515	0.66
30_T	168_A	0.512	0.66
66_F	147_H	0.511	0.66
30_T	34_V	0.509	0.65
95_P	109_H	0.508	0.65
27_N	30_T	0.506	0.65
94_D	99_G	0.506	0.65
109_H	160_L	0.505	0.65
91_G	147_H	0.500	0.64

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1z9nA	2	0.8902	100	0.143	Contact Map
4l05A	1	0.8844	100	0.187	Contact Map
2aqpA	3	0.8902	100	0.189	Contact Map
1eqwA	2	0.8902	100	0.193	Contact Map
1esoA	1	0.8844	100	0.197	Contact Map
1oalA	1	0.8671	100	0.201	Contact Map
3pu7A	2	0.8266	100	0.234	Contact Map
3f7lA	2	0.8208	100	0.234	Contact Map
2e47A	2	0.8439	100	0.235	Contact Map
2q2lA	1	0.8092	100	0.238	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.