YHID - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YHID - Putative magnesium transporter YhiD

UniProt:	P0AFV2	Sequences: MTAEFIIRLILAAIACGAIGMERQMRGKGAGLRTHVLIGMGSALFMIVSKYGFADVLSLDHVGLDPSRIAAQVVTGVGFIGAGNILVRNQNIVGLTTAADIWVTAAIGMVIGSGMYELGIYGSVMTLLVLEVFHQLTFRLMNKNYHLQLTLVNGNTVSMLDWFKQQKIKTDLVSLQENEDHEVVAIDIQLHATTSIEDLLRLLKGMAGVKGVSIS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11400
Length:	215 (202)
Sequences:	1853 (1468)
Seq/√Len:	103.3

ECOLI - YHID
BACSU - SAPB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
12_A	43_A	5.558	1.00
16_C	39_G	4.807	1.00
45_F	106_A	4.494	1.00
44_L	122_G	4.301	1.00
73_V	109_M	4.183	1.00
111_I	119_G	3.326	1.00
46_M	109_M	3.129	1.00
103_V	126_T	3.080	1.00
15_A	111_I	2.915	1.00
15_A	123_S	2.617	1.00
17_G	32_L	2.612	1.00
13_A	36_V	2.477	1.00
72_Q	75_T	2.396	1.00
41_G	103_V	2.257	1.00
65_D	68_R	2.203	1.00
15_A	119_G	2.137	1.00
8_R	114_G	2.066	1.00
50_K	55_D	2.058	1.00
6_I	121_Y	2.024	1.00
19_I	104_T	1.958	1.00
35_H	100_D	1.947	1.00
45_F	69_I	1.849	1.00
17_G	36_V	1.847	1.00
128_L	132_V	1.839	1.00
5_F	118_L	1.836	1.00
107_I	123_S	1.810	1.00
42_S	105_A	1.760	1.00
36_V	129_V	1.722	1.00
46_M	113_S	1.653	1.00
15_A	120_I	1.637	1.00
37_L	41_G	1.618	1.00
71_A	75_T	1.585	1.00
115_M	118_L	1.583	1.00
43_A	111_I	1.571	1.00
52_G	67_S	1.551	1.00
45_F	74_V	1.535	1.00
64_L	67_S	1.535	1.00
40_M	125_M	1.533	1.00
107_I	126_T	1.533	1.00
16_C	104_T	1.528	1.00
8_R	116_Y	1.520	1.00
48_V	113_S	1.514	1.00
69_I	74_V	1.507	1.00
6_I	10_I	1.507	1.00
41_G	105_A	1.474	1.00
18_A	127_L	1.449	1.00
10_I	14_I	1.433	1.00
84_N	101_I	1.418	1.00
82_A	86_L	1.403	1.00
11_L	120_I	1.391	1.00
9_L	125_M	1.313	0.99
13_A	125_M	1.301	0.99
70_A	106_A	1.281	0.99
69_I	115_M	1.274	0.99
166_Q	202_L	1.263	0.99
96_T	130_L	1.253	0.99
4_E	8_R	1.235	0.99
35_H	104_T	1.207	0.99
35_H	130_L	1.201	0.99
53_F	64_L	1.199	0.99
151_L	154_G	1.198	0.99
80_I	85_I	1.196	0.99
201_R	204_K	1.178	0.99
4_E	116_Y	1.162	0.98
92_I	127_L	1.162	0.98
13_A	40_M	1.159	0.98
84_N	109_M	1.158	0.98
100_D	130_L	1.152	0.98
121_Y	124_V	1.132	0.98
202_L	206_M	1.126	0.98
41_G	77_V	1.125	0.98
5_F	8_R	1.123	0.98
32_L	36_V	1.116	0.98
87_V	90_Q	1.116	0.98
46_M	70_A	1.099	0.98
70_A	74_V	1.098	0.98
191_H	194_T	1.095	0.98
74_V	106_A	1.094	0.98
162_W	166_Q	1.092	0.98
53_F	66_P	1.092	0.98
76_G	105_A	1.092	0.98
53_F	67_S	1.086	0.97
45_F	75_T	1.075	0.97
198_D	201_R	1.075	0.97
48_V	110_V	1.070	0.97
201_R	205_G	1.066	0.97
160_L	170_T	1.064	0.97
120_I	124_V	1.060	0.97
8_R	47_I	1.032	0.97
46_M	73_V	1.030	0.96
49_S	70_A	1.030	0.96
68_R	77_V	1.022	0.96
165_Q	202_L	1.020	0.96
37_L	103_V	1.011	0.96
13_A	129_V	1.009	0.96
48_V	69_I	1.008	0.96
53_F	88_R	0.997	0.96
41_G	72_Q	0.992	0.96
195_S	198_D	0.988	0.96
16_C	43_A	0.988	0.96
84_N	87_V	0.985	0.95
38_I	100_D	0.979	0.95
46_M	112_G	0.969	0.95
10_I	125_M	0.964	0.95
38_I	101_I	0.961	0.95
12_A	141_M	0.960	0.95
28_K	72_Q	0.960	0.95
63_G	69_I	0.958	0.95
24_Q	32_L	0.958	0.95
15_A	130_L	0.957	0.95
74_V	105_A	0.955	0.95
88_R	93_V	0.954	0.95
147_L	155_N	0.947	0.94
50_K	113_S	0.945	0.94
11_L	111_I	0.936	0.94
49_S	113_S	0.921	0.94
28_K	88_R	0.912	0.93
28_K	84_N	0.912	0.93
24_Q	130_L	0.902	0.93
25_M	37_L	0.901	0.93
66_P	72_Q	0.901	0.93
65_D	72_Q	0.899	0.93
15_A	107_I	0.892	0.92
11_L	116_Y	0.888	0.92
38_I	84_N	0.886	0.92
24_Q	134_H	0.882	0.92
49_S	72_Q	0.875	0.92
163_F	168_I	0.869	0.91
76_G	98_A	0.868	0.91
46_M	64_L	0.862	0.91
24_Q	78_G	0.852	0.91
158_S	161_D	0.852	0.91
16_C	87_V	0.851	0.91
161_D	165_Q	0.847	0.90
139_R	142_N	0.846	0.90
45_F	109_M	0.843	0.90
162_W	165_Q	0.838	0.90
130_L	134_H	0.834	0.90
24_Q	141_M	0.827	0.89
12_A	16_C	0.825	0.89
18_A	148_Q	0.819	0.89
145_Y	151_L	0.814	0.89
21_M	73_V	0.813	0.88
47_I	51_Y	0.811	0.88
32_L	130_L	0.807	0.88
40_M	103_V	0.805	0.88
70_A	109_M	0.804	0.88
75_T	106_A	0.796	0.87
152_V	155_N	0.795	0.87
17_G	133_F	0.790	0.87
30_A	41_G	0.789	0.87
203_L	209_V	0.787	0.87
82_A	125_M	0.783	0.87
96_T	109_M	0.783	0.87
161_D	164_K	0.779	0.86
37_L	126_T	0.779	0.86
52_G	87_V	0.772	0.86
38_I	80_I	0.771	0.86
6_I	123_S	0.764	0.85
30_A	101_I	0.751	0.84
33_R	36_V	0.750	0.84
152_V	203_L	0.748	0.84
26_R	43_A	0.744	0.84
129_V	133_F	0.741	0.83
12_A	39_G	0.740	0.83
53_F	115_M	0.734	0.83
144_N	181_H	0.731	0.83
69_I	109_M	0.729	0.82
38_I	200_L	0.725	0.82
97_T	101_I	0.720	0.82
111_I	116_Y	0.717	0.81
30_A	100_D	0.712	0.81
73_V	105_A	0.711	0.81
183_V	210_K	0.711	0.81
52_G	55_D	0.710	0.81
79_F	83_G	0.709	0.81
53_F	65_D	0.704	0.80
39_G	115_M	0.703	0.80
50_K	86_L	0.702	0.80
28_K	101_I	0.702	0.80
165_Q	198_D	0.700	0.80
73_V	135_Q	0.696	0.79
7_I	116_Y	0.694	0.79
32_L	137_T	0.692	0.79
126_T	130_L	0.691	0.79
37_L	130_L	0.687	0.78
30_A	37_L	0.685	0.78
52_G	64_L	0.685	0.78
101_I	151_L	0.684	0.78
117_E	121_Y	0.682	0.78
104_T	130_L	0.677	0.77
77_V	105_A	0.676	0.77
68_R	92_I	0.674	0.77
14_I	17_G	0.674	0.77
152_V	207_A	0.672	0.77
45_F	63_G	0.665	0.76
39_G	104_T	0.661	0.76
139_R	174_S	0.661	0.76
14_I	138_F	0.660	0.76
27_G	141_M	0.655	0.75
64_L	115_M	0.650	0.75
124_V	183_V	0.649	0.74
92_I	95_L	0.648	0.74
152_V	210_K	0.646	0.74
24_Q	137_T	0.644	0.74
101_I	134_H	0.644	0.74
47_I	114_G	0.641	0.74
44_L	70_A	0.634	0.73
92_I	174_S	0.632	0.73
82_A	95_L	0.629	0.72
164_K	169_K	0.626	0.72
88_R	91_N	0.622	0.71
117_E	128_L	0.621	0.71
163_F	175_L	0.621	0.71
158_S	191_H	0.617	0.71
202_L	205_G	0.616	0.71
36_V	133_F	0.614	0.70
148_Q	181_H	0.613	0.70
30_A	97_T	0.613	0.70
181_H	206_M	0.612	0.70
72_Q	76_G	0.612	0.70
15_A	50_K	0.612	0.70
17_G	116_Y	0.610	0.70
121_Y	153_N	0.609	0.70
5_F	112_G	0.605	0.69
42_S	125_M	0.604	0.69
13_A	26_R	0.601	0.69
148_Q	199_L	0.601	0.69
78_G	83_G	0.598	0.68
120_I	154_G	0.597	0.68
48_V	112_G	0.595	0.68
22_E	91_N	0.594	0.68
177_E	180_D	0.593	0.68
74_V	147_L	0.590	0.67
174_S	185_A	0.590	0.67
130_L	137_T	0.589	0.67
163_F	186_I	0.588	0.67
9_L	121_Y	0.587	0.67
182_E	190_L	0.581	0.66
40_M	159_M	0.577	0.66
48_V	126_T	0.573	0.65
122_G	208_G	0.573	0.65
195_S	201_R	0.573	0.65
146_H	167_K	0.572	0.65
71_A	74_V	0.572	0.65
206_M	209_V	0.571	0.65
198_D	202_L	0.570	0.65
161_D	179_E	0.568	0.64
25_M	129_V	0.568	0.64
38_I	77_V	0.564	0.64
50_K	69_I	0.563	0.64
67_S	72_Q	0.562	0.64
19_I	163_F	0.562	0.64
45_F	111_I	0.561	0.63
66_P	69_I	0.561	0.63
19_I	35_H	0.561	0.63
35_H	38_I	0.558	0.63
4_E	86_L	0.557	0.63
171_D	189_Q	0.557	0.63
158_S	206_M	0.557	0.63
159_M	203_L	0.555	0.63
29_G	77_V	0.554	0.62
54_A	62_V	0.554	0.62
106_A	111_I	0.553	0.62
28_K	48_V	0.553	0.62
8_R	51_Y	0.546	0.61
197_E	200_L	0.545	0.61
36_V	104_T	0.544	0.61
187_D	195_S	0.542	0.61
28_K	33_R	0.538	0.60
33_R	123_S	0.536	0.60
78_G	119_G	0.535	0.60
197_E	201_R	0.533	0.60
26_R	29_G	0.533	0.60
169_K	189_Q	0.532	0.59
35_H	134_H	0.532	0.59
51_Y	115_M	0.532	0.59
168_I	203_L	0.527	0.59
39_G	137_T	0.526	0.59
68_R	79_F	0.525	0.58
168_I	191_H	0.525	0.58
48_V	72_Q	0.524	0.58
43_A	47_I	0.524	0.58
29_G	36_V	0.522	0.58
87_V	91_N	0.522	0.58
81_G	86_L	0.521	0.58
19_I	95_L	0.521	0.58
37_L	93_V	0.520	0.58
128_L	186_I	0.515	0.57
20_G	23_R	0.512	0.57
169_K	191_H	0.512	0.57
193_T	201_R	0.511	0.56
164_K	196_I	0.511	0.56
38_I	46_M	0.510	0.56
5_F	15_A	0.509	0.56
92_I	190_L	0.507	0.56
188_I	211_G	0.506	0.56
27_G	103_V	0.506	0.56
161_D	198_D	0.504	0.55
38_I	49_S	0.502	0.55
51_Y	118_L	0.501	0.55
101_I	189_Q	0.500	0.55
41_G	107_I	0.500	0.55

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ko1A	2	0.3535	94.6	0.913	Contact Map
1y7pA	5	0.3442	94	0.916	Contact Map
2lvwA	2	0.3674	91.4	0.923	Contact Map
2pc6A	2	0.3395	90.8	0.924	Contact Map
1zpvA	3	0.3488	89.9	0.925	Contact Map
2f1fA	4	0.3349	89.1	0.926	Contact Map
2lqjA	1	0.3628	86.3	0.93	Contact Map
2fgcA	2	0.3395	74.9	0.938	Contact Map
2djwA	6	0.3302	46.7	0.948	Contact Map
2cviA	2	0.3302	45.3	0.948	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.