OGT - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

OGT - Methylated-DNA--protein-cysteine methyltransferase

UniProt:	P0AFH0	Sequences: MLRLLEEKIATPLGPLWVICDEQFRLRAVEWEEYSERMVQLLDIHYRKEGYERISATNPGGLSDKLREYFAGNLSIIDTLPTATGGTPFQREVWKTLRTIPCGQVMHYGQLAEQLGRPGAARAVGAANGSNPISIVVPCHRVIGRNGTMTGYAGGVQRKEWLLRHEGYLLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10668
Length:	171 (156)
Sequences:	5683 (4195)
Seq/√Len:	335.8

ECOLI - OGT ADA
BACSU - ADAB OGT
SULSO - OGT

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
144_G	150_T	3.423	1.00
68_E	74_L	3.307	1.00
92_E	117_R	3.017	1.00
161_W	165_H	2.919	1.00
96_T	99_T	2.682	1.00
106_M	114_Q	2.661	1.00
109_G	145_R	2.502	1.00
21_D	83_A	2.466	1.00
160_E	164_R	2.301	1.00
106_M	110_Q	2.272	1.00
10_A	15_P	2.237	1.00
109_G	113_E	2.083	1.00
84_T	137_V	2.058	1.00
106_M	111_L	2.049	1.00
21_D	25_R	2.027	1.00
96_T	111_L	1.968	1.00
96_T	114_Q	1.927	1.00
7_E	63_S	1.906	1.00
86_G	94_W	1.901	1.00
68_E	73_N	1.856	1.00
18_V	26_L	1.764	1.00
65_K	77_I	1.757	1.00
20_C	59_P	1.725	1.00
25_R	83_A	1.719	1.00
110_Q	113_E	1.659	1.00
87_T	90_Q	1.656	1.00
29_V	136_V	1.652	1.00
117_R	120_A	1.626	1.00
8_K	15_P	1.609	1.00
61_G	65_K	1.584	1.00
9_I	67_R	1.580	1.00
95_K	98_R	1.536	1.00
149_M	156_V	1.522	1.00
100_I	142_V	1.514	1.00
90_Q	130_S	1.463	1.00
21_D	27_R	1.457	1.00
97_L	128_N	1.441	1.00
109_G	121_A	1.425	1.00
121_A	125_G	1.411	1.00
151_G	156_V	1.398	1.00
100_I	106_M	1.390	1.00
96_T	115_L	1.382	1.00
134_S	154_G	1.372	1.00
12_P	70_F	1.370	1.00
86_G	90_Q	1.367	1.00
99_T	114_Q	1.367	1.00
65_K	80_L	1.355	1.00
61_G	64_D	1.341	1.00
31_W	158_R	1.336	1.00
93_V	111_L	1.332	1.00
161_W	164_R	1.331	1.00
106_M	142_V	1.326	1.00
164_R	167_G	1.307	1.00
126_A	129_G	1.253	1.00
129_G	150_T	1.234	1.00
62_L	136_V	1.227	1.00
18_V	62_L	1.209	1.00
23_Q	83_A	1.204	1.00
91_R	95_K	1.193	1.00
65_K	74_L	1.179	1.00
11_T	16_L	1.144	1.00
19_I	28_A	1.128	1.00
31_W	134_S	1.124	1.00
126_A	150_T	1.122	1.00
157_Q	160_E	1.108	1.00
95_K	99_T	1.105	1.00
22_E	25_R	1.097	1.00
126_A	130_S	1.094	1.00
113_E	118_P	1.081	1.00
63_S	67_R	1.079	1.00
20_C	62_L	1.075	1.00
84_T	91_R	1.071	1.00
98_R	137_V	1.055	1.00
84_T	133_I	1.043	1.00
19_I	27_R	1.027	1.00
11_T	14_G	1.025	1.00
82_T	133_I	1.022	1.00
65_K	75_S	1.020	1.00
105_V	163_L	1.017	1.00
84_T	132_P	1.013	1.00
33_E	158_R	1.012	1.00
26_L	62_L	1.002	1.00
128_N	143_I	1.002	1.00
64_D	68_E	1.001	1.00
20_C	56_A	1.001	1.00
129_G	155_G	0.997	1.00
13_L	161_W	0.992	1.00
9_I	63_S	0.986	1.00
80_L	136_V	0.984	1.00
125_G	129_G	0.972	1.00
88_P	91_R	0.967	1.00
15_P	32_E	0.964	1.00
150_T	156_V	0.960	1.00
66_L	70_F	0.955	1.00
56_A	59_P	0.950	1.00
67_R	71_A	0.947	1.00
8_K	17_W	0.942	1.00
55_S	60_G	0.942	1.00
90_Q	94_W	0.928	1.00
13_L	158_R	0.904	1.00
115_L	124_V	0.901	1.00
69_Y	165_H	0.900	1.00
16_L	29_V	0.896	1.00
18_V	59_P	0.884	1.00
75_S	102_C	0.883	1.00
158_R	161_W	0.882	1.00
101_P	104_Q	0.880	1.00
13_L	16_L	0.876	1.00
29_V	66_L	0.873	1.00
96_T	106_M	0.870	1.00
115_L	120_A	0.868	1.00
29_V	133_I	0.868	1.00
129_G	153_A	0.865	1.00
65_K	78_D	0.863	1.00
89_F	127_A	0.840	1.00
111_L	128_N	0.839	1.00
7_E	59_P	0.828	1.00
27_R	85_G	0.825	1.00
58_N	81_P	0.815	1.00
26_L	136_V	0.809	1.00
144_G	148_T	0.807	1.00
17_W	32_E	0.801	1.00
88_P	92_E	0.799	1.00
93_V	115_L	0.796	1.00
90_Q	126_A	0.785	1.00
131_N	139_C	0.776	1.00
164_R	168_Y	0.775	1.00
89_F	123_A	0.767	1.00
59_P	62_L	0.764	1.00
92_E	95_K	0.757	1.00
128_N	134_S	0.757	1.00
144_G	151_G	0.755	1.00
58_N	62_L	0.744	0.99
134_S	153_A	0.742	0.99
128_N	152_Y	0.738	0.99
6_E	19_I	0.737	0.99
7_E	60_G	0.737	0.99
58_N	61_G	0.730	0.99
134_S	158_R	0.721	0.99
89_F	93_V	0.721	0.99
149_M	160_E	0.719	0.99
25_R	58_N	0.718	0.99
135_I	165_H	0.713	0.99
9_I	16_L	0.711	0.99
94_W	97_L	0.709	0.99
92_E	115_L	0.699	0.99
18_V	29_V	0.698	0.99
20_C	58_N	0.670	0.99
62_L	65_K	0.670	0.99
85_G	91_R	0.666	0.99
93_V	124_V	0.665	0.99
29_V	134_S	0.662	0.99
120_A	123_A	0.659	0.99
9_I	18_V	0.657	0.99
39_V	42_L	0.657	0.99
50_G	54_I	0.656	0.99
8_K	32_E	0.654	0.99
34_Y	38_M	0.652	0.99
5_L	58_N	0.650	0.99
110_Q	114_Q	0.648	0.99
144_G	149_M	0.648	0.99
25_R	82_T	0.640	0.98
111_L	115_L	0.639	0.98
30_E	37_R	0.634	0.98
30_E	134_S	0.631	0.98
107_H	145_R	0.630	0.98
109_G	125_G	0.628	0.98
30_E	34_Y	0.627	0.98
97_L	111_L	0.626	0.98
28_A	134_S	0.626	0.98
74_L	77_I	0.624	0.98
111_L	124_V	0.622	0.98
67_R	70_F	0.620	0.98
135_I	162_L	0.620	0.98
111_L	125_G	0.620	0.98
17_W	30_E	0.612	0.98
74_L	102_C	0.607	0.98
34_Y	37_R	0.604	0.98
69_Y	135_I	0.604	0.98
37_R	41_L	0.603	0.98
25_R	81_P	0.599	0.98
66_L	69_Y	0.596	0.98
70_F	165_H	0.596	0.98
27_R	83_A	0.593	0.97
20_C	23_Q	0.591	0.97
57_T	60_G	0.590	0.97
62_L	80_L	0.585	0.97
105_V	168_Y	0.585	0.97
82_T	98_R	0.580	0.97
86_G	91_R	0.577	0.97
150_T	153_A	0.576	0.97
5_L	22_E	0.575	0.97
133_I	137_V	0.572	0.97
36_E	40_Q	0.571	0.97
64_D	67_R	0.568	0.97
131_N	155_G	0.567	0.97
102_C	165_H	0.567	0.97
50_G	53_R	0.563	0.97
26_L	58_N	0.561	0.96
106_M	128_N	0.558	0.96
30_E	41_L	0.556	0.96
84_T	98_R	0.556	0.96
36_E	130_S	0.555	0.96
69_Y	102_C	0.553	0.96
111_L	114_Q	0.546	0.96
37_R	40_Q	0.546	0.96
38_M	42_L	0.545	0.96
121_A	126_A	0.543	0.96
107_H	110_Q	0.543	0.96
111_L	142_V	0.543	0.96
65_K	68_E	0.542	0.96
77_I	102_C	0.539	0.96
105_V	143_I	0.533	0.95
133_I	136_V	0.531	0.95
55_S	58_N	0.530	0.95
69_Y	77_I	0.529	0.95
66_L	136_V	0.529	0.95
139_C	155_G	0.527	0.95
66_L	135_I	0.526	0.95
12_P	71_A	0.525	0.95
156_V	160_E	0.523	0.95
69_Y	74_L	0.520	0.95
107_H	144_G	0.520	0.95
84_T	94_W	0.519	0.95
12_P	165_H	0.518	0.95
144_G	156_V	0.517	0.94
150_T	159_K	0.516	0.94
69_Y	72_G	0.512	0.94
5_L	55_S	0.510	0.94
100_I	128_N	0.509	0.94
16_L	31_W	0.505	0.94
31_W	152_Y	0.503	0.94
52_E	55_S	0.501	0.93
35_S	39_V	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1sfeA	1	0.9649	100	0.15	Contact Map
4bhbA	1	0.924	100	0.166	Contact Map
3l00A	1	0.8655	100	0.177	Contact Map
1eh6A	1	0.9181	100	0.18	Contact Map
1wrjA	1	0.8713	100	0.19	Contact Map
2g7hA	1	0.8655	100	0.299	Contact Map
1mgtA	1	0.924	100	0.318	Contact Map
2kifA	1	0.5029	100	0.402	Contact Map
3gvaA	1	0.5088	100	0.405	Contact Map
3ugoA	1	0.4211	49.4	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.