NUOK - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NUOK - NADH-quinone oxidoreductase subunit K

UniProt:	P0AFE4	Sequences: MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12091
Length:	100 (96)
Sequences:	1573 (747)
Seq/√Len:	76.3

ECOLI - NUOK
HALSA - Q9HRL4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_G	34_G	6.162	1.00
4_L	52_Y	2.934	1.00
89_N	94_S	2.639	1.00
32_L	45_A	2.565	1.00
43_A	65_A	2.518	1.00
4_L	48_V	2.300	1.00
46_F	61_M	2.272	1.00
15_F	38_M	2.249	1.00
45_A	49_A	2.173	1.00
91_N	94_S	2.108	1.00
9_I	13_I	2.049	1.00
42_S	45_A	1.982	1.00
7_G	48_V	1.948	1.00
31_M	92_I	1.811	1.00
19_L	38_M	1.752	1.00
45_A	48_V	1.743	1.00
83_L	95_V	1.729	1.00
24_I	40_N	1.703	1.00
87_R	97_E	1.689	1.00
10_L	14_L	1.670	1.00
20_T	24_I	1.633	1.00
11_A	45_A	1.590	0.99
46_F	58_G	1.560	0.99
30_F	33_I	1.551	0.99
23_V	30_F	1.529	0.99
40_N	66_I	1.511	0.99
40_N	83_L	1.465	0.99
20_T	77_L	1.414	0.99
4_L	53_W	1.381	0.99
82_Q	85_R	1.356	0.98
62_Y	66_I	1.325	0.98
8_L	45_A	1.315	0.98
19_L	22_L	1.275	0.98
22_L	34_G	1.272	0.97
28_L	92_I	1.236	0.97
10_L	44_L	1.153	0.96
50_G	56_T	1.109	0.94
75_I	82_Q	1.073	0.93
8_L	12_A	1.073	0.93
89_N	96_S	1.050	0.93
14_L	77_L	1.025	0.92
32_L	80_L	1.019	0.92
19_L	84_H	0.998	0.91
13_I	17_L	0.993	0.90
28_L	35_L	0.988	0.90
18_G	38_M	0.977	0.90
18_G	31_M	0.975	0.90
63_I	67_S	0.974	0.90
20_T	66_I	0.947	0.88
26_R	66_I	0.938	0.88
69_A	76_G	0.930	0.87
22_L	38_M	0.921	0.87
11_A	56_T	0.916	0.87
37_I	49_A	0.911	0.86
74_S	79_L	0.904	0.86
8_L	49_A	0.897	0.85
40_N	73_A	0.896	0.85
46_F	90_L	0.884	0.85
22_L	31_M	0.868	0.83
40_N	43_A	0.863	0.83
44_L	48_V	0.858	0.83
92_I	95_V	0.856	0.83
45_A	62_Y	0.854	0.82
10_L	63_I	0.851	0.82
41_A	44_L	0.814	0.79
28_L	73_A	0.814	0.79
10_L	48_V	0.792	0.77
46_F	59_Q	0.769	0.75
16_V	20_T	0.768	0.75
22_L	66_I	0.762	0.75
11_A	41_A	0.760	0.74
50_G	81_L	0.753	0.74
17_L	21_G	0.745	0.73
25_R	57_D	0.745	0.73
30_F	79_L	0.741	0.73
7_G	67_S	0.729	0.71
78_A	82_Q	0.725	0.71
6_H	9_I	0.717	0.70
38_M	76_G	0.715	0.70
18_G	34_G	0.713	0.70
76_G	87_R	0.711	0.69
87_R	95_V	0.701	0.68
35_L	78_A	0.691	0.67
6_H	10_L	0.687	0.67
50_G	60_V	0.682	0.66
43_A	62_Y	0.679	0.66
12_A	16_V	0.666	0.64
7_G	79_L	0.664	0.64
32_L	71_A	0.660	0.64
54_G	57_D	0.649	0.62
25_R	30_F	0.647	0.62
26_R	63_I	0.643	0.62
27_N	90_L	0.642	0.62
54_G	95_V	0.625	0.60
11_A	29_L	0.616	0.58
24_I	63_I	0.616	0.58
21_G	67_S	0.613	0.58
11_A	17_L	0.604	0.57
30_F	73_A	0.603	0.57
95_V	98_M	0.599	0.56
49_A	71_A	0.593	0.56
64_L	70_A	0.590	0.55
64_L	67_S	0.585	0.55
35_L	39_I	0.582	0.54
62_Y	91_N	0.582	0.54
26_R	85_R	0.580	0.54
48_V	52_Y	0.575	0.53
42_S	99_R	0.574	0.53
67_S	82_Q	0.572	0.53
51_S	82_Q	0.572	0.53
11_A	15_F	0.571	0.53
21_G	53_W	0.565	0.52
18_G	40_N	0.564	0.52
37_I	71_A	0.562	0.52
52_Y	65_A	0.558	0.51
72_E	75_I	0.558	0.51
43_A	49_A	0.552	0.50
66_I	82_Q	0.543	0.49
29_L	95_V	0.542	0.49
26_R	93_D	0.541	0.49
69_A	73_A	0.541	0.49
9_I	12_A	0.540	0.49
42_S	53_W	0.537	0.48
78_A	96_S	0.536	0.48
34_G	63_I	0.531	0.48
50_G	61_M	0.530	0.48
83_L	86_R	0.526	0.47
73_A	80_L	0.526	0.47
11_A	44_L	0.524	0.47
12_A	73_A	0.521	0.46
39_I	68_L	0.521	0.46
28_L	93_D	0.519	0.46
40_N	75_I	0.518	0.46
57_D	97_E	0.517	0.46
87_R	94_S	0.515	0.46
27_N	33_I	0.515	0.46
33_I	65_A	0.514	0.46
65_A	77_L	0.512	0.45
31_M	90_L	0.511	0.45
78_A	86_R	0.507	0.45
30_F	50_G	0.505	0.44
31_M	42_S	0.503	0.44
6_H	98_M	0.501	0.44
52_Y	56_T	0.500	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rkoK	1	1	99.9	0.367	Contact Map
4he8K	1	0.95	99.9	0.439	Contact Map
3rkoM	1	0.99	9.8	0.932	Contact Map
3rkoL	1	0.95	9.7	0.932	Contact Map
3rkoN	1	0.93	8.4	0.934	Contact Map
4he8M	1	0.96	8.1	0.934	Contact Map
2kluA	1	0.49	5.9	0.938	Contact Map
4he8L	1	0.95	5.6	0.938	Contact Map
4cz8A	2	0.84	3.7	0.944	Contact Map
1m5wA	5	0.62	3.1	0.946	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.