NUOA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NUOA - NADH-quinone oxidoreductase subunit A

UniProt:	P0AFC3	Sequences: MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12082
Length:	147 (112)
Sequences:	4168 (1955)
Seq/√Len:	184.7

ECOLI - NUOA
HALSA - Q9HRM1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
102_E	117_L	4.546	1.00
88_W	103_A	3.759	1.00
26_L	30_M	3.488	1.00
34_G	38_G	3.094	1.00
25_G	29_L	3.029	1.00
116_Y	119_R	2.681	1.00
95_S	99_G	2.633	1.00
116_Y	120_I	2.510	1.00
67_K	126_T	2.397	1.00
98_V	102_E	2.338	1.00
42_R	47_N	2.196	1.00
24_I	28_C	2.033	1.00
85_L	103_A	2.009	1.00
68_F	71_V	1.935	1.00
109_V	117_L	1.918	1.00
35_W	40_R	1.906	1.00
21_I	25_G	1.869	1.00
91_S	94_E	1.864	1.00
111_L	115_V	1.836	1.00
109_V	113_G	1.828	1.00
101_V	104_A	1.797	1.00
46_K	113_G	1.785	1.00
30_M	33_G	1.768	1.00
45_S	48_V	1.766	1.00
48_V	55_D	1.750	1.00
28_C	32_V	1.689	1.00
20_L	23_A	1.513	1.00
101_V	105_I	1.476	1.00
43_A	48_V	1.425	1.00
49_P	65_S	1.330	1.00
100_F	104_A	1.306	1.00
99_G	102_E	1.269	1.00
37_L	40_R	1.266	1.00
82_A	117_L	1.215	1.00
96_G	99_G	1.173	1.00
48_V	54_I	1.166	1.00
22_V	26_L	1.150	1.00
81_E	110_L	1.127	1.00
97_W	101_V	1.125	1.00
114_L	123_L	1.093	1.00
118_V	125_W	1.088	1.00
111_L	117_L	1.057	1.00
47_N	50_F	1.044	1.00
48_V	56_S	1.040	1.00
75_F	78_F	1.032	1.00
117_L	123_L	1.025	1.00
84_Y	120_I	1.003	0.99
85_L	122_A	0.979	0.99
27_C	85_L	0.977	0.99
118_V	124_D	0.977	0.99
71_V	117_L	0.970	0.99
50_F	120_I	0.966	0.99
63_R	69_Y	0.959	0.99
21_I	98_V	0.944	0.99
115_V	119_R	0.926	0.99
74_F	122_A	0.924	0.99
29_L	32_V	0.881	0.99
74_F	80_V	0.872	0.98
75_F	79_D	0.866	0.98
80_V	83_L	0.859	0.98
54_I	65_S	0.858	0.98
58_G	62_L	0.857	0.98
65_S	69_Y	0.841	0.98
86_F	89_S	0.837	0.98
105_I	109_V	0.832	0.98
32_V	36_F	0.830	0.98
83_L	86_F	0.829	0.98
32_V	35_W	0.822	0.98
103_A	106_F	0.818	0.98
65_S	73_M	0.809	0.98
91_S	97_W	0.807	0.97
63_R	73_M	0.801	0.97
55_D	83_L	0.799	0.97
28_C	98_V	0.799	0.97
31_L	35_W	0.797	0.97
39_G	68_F	0.794	0.97
66_A	74_F	0.791	0.97
88_W	100_F	0.784	0.97
110_L	114_L	0.780	0.97
33_G	93_R	0.778	0.97
17_A	28_C	0.775	0.97
20_L	24_I	0.773	0.97
21_I	24_I	0.770	0.97
98_V	103_A	0.761	0.96
71_V	124_D	0.759	0.96
34_G	37_L	0.751	0.96
50_F	116_Y	0.743	0.96
38_G	50_F	0.737	0.96
15_A	18_I	0.736	0.96
24_I	27_C	0.736	0.96
69_Y	125_W	0.734	0.96
48_V	52_S	0.721	0.95
45_S	54_I	0.719	0.95
93_R	114_L	0.716	0.95
20_L	94_E	0.708	0.95
98_V	101_V	0.706	0.95
93_R	124_D	0.703	0.94
34_G	40_R	0.700	0.94
70_L	73_M	0.694	0.94
54_I	68_F	0.692	0.94
76_V	112_A	0.692	0.94
78_F	110_L	0.691	0.94
75_F	110_L	0.687	0.94
68_F	97_W	0.687	0.94
110_L	113_G	0.684	0.94
32_V	105_I	0.677	0.93
115_V	118_V	0.666	0.93
62_L	74_F	0.664	0.93
82_A	111_L	0.662	0.92
20_L	42_R	0.656	0.92
88_W	96_G	0.653	0.92
85_L	90_T	0.652	0.92
92_I	97_W	0.649	0.92
86_F	106_F	0.643	0.91
26_L	106_F	0.635	0.91
18_I	32_V	0.631	0.91
44_R	119_R	0.621	0.90
69_Y	116_Y	0.620	0.90
26_L	29_L	0.619	0.90
108_F	111_L	0.610	0.89
67_K	122_A	0.610	0.89
15_A	23_A	0.608	0.89
121_G	126_T	0.607	0.89
29_L	35_W	0.605	0.89
21_I	112_A	0.601	0.88
95_S	98_V	0.593	0.88
46_K	72_A	0.589	0.87
22_V	25_G	0.587	0.87
57_V	71_V	0.587	0.87
38_G	80_V	0.585	0.87
89_S	96_G	0.585	0.87
84_Y	89_S	0.583	0.87
61_R	71_V	0.578	0.86
59_S	62_L	0.578	0.86
52_S	71_V	0.577	0.86
72_A	122_A	0.572	0.86
103_A	126_T	0.568	0.85
21_I	96_G	0.567	0.85
27_C	31_L	0.567	0.85
19_F	27_C	0.566	0.85
42_R	102_E	0.566	0.85
99_G	103_A	0.566	0.85
33_G	118_V	0.563	0.85
65_S	68_F	0.562	0.85
52_S	63_R	0.557	0.84
68_F	119_R	0.556	0.84
55_D	63_R	0.553	0.84
52_S	76_V	0.551	0.84
19_F	83_L	0.549	0.83
98_V	112_A	0.547	0.83
105_I	112_A	0.544	0.83
34_G	42_R	0.541	0.83
67_K	125_W	0.537	0.82
74_F	117_L	0.533	0.82
15_A	80_V	0.523	0.80
46_K	52_S	0.515	0.79
67_K	89_S	0.513	0.79
23_A	72_A	0.511	0.79
88_W	91_S	0.510	0.79
59_S	114_L	0.508	0.79
106_F	110_L	0.508	0.79
49_P	59_S	0.507	0.78
82_A	126_T	0.506	0.78
57_V	83_L	0.506	0.78
90_T	94_E	0.504	0.78
34_G	75_F	0.503	0.78
63_R	76_V	0.503	0.78
29_L	33_G	0.500	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rkoA	1	0.6463	100	0.157	Contact Map
4he8A	1	0.6259	100	0.268	Contact Map
4djkA	2	0.7687	9.1	0.947	Contact Map
3mk7C	2	0.7211	8.7	0.947	Contact Map
2ls2A	1	0.1701	4.4	0.954	Contact Map
3wajA	1	0.6939	3.7	0.956	Contact Map
4jkvA	2	0.8367	3.7	0.956	Contact Map
2mv6A	1	0.3333	3.7	0.956	Contact Map
4tllB	2	0.2653	3.5	0.956	Contact Map
4tllA	1	0.1429	3.4	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.