YJBQ - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YJBQ - UPF0047 protein YjbQ

UniProt:	P0AF48	Sequences: MWYQKTLTLSAKSRGFHLVTDEILNQLADMPRVNIGLLHLLLQHTSASLTLNENCDPTVRHDMERFFLRTVPDNGNYEHDYEGADDMPSHIKSSMLGTSLVLPVHKGRIQTGTWQGIWLGEHRIHGGSRRIIATLQGE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11935
Length:	138 (129)
Sequences:	2781 (1832)
Seq/√Len:	161.3

ECOLI - YJBQ
BACSU - YUGU
SULSO - Q97VS8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_K	29_D	3.454	1.00
23_I	117_I	2.962	1.00
6_T	130_R	2.679	1.00
48_S	122_H	2.646	1.00
105_H	110_Q	2.633	1.00
38_L	133_A	2.506	1.00
61_H	78_E	2.409	1.00
65_R	78_E	2.227	1.00
22_E	25_N	2.205	1.00
42_L	47_A	2.152	1.00
33_V	135_L	2.135	1.00
7_L	133_A	2.130	1.00
50_T	94_S	2.113	1.00
8_T	128_S	2.075	1.00
43_Q	130_R	2.030	1.00
26_Q	133_A	1.989	1.00
40_L	133_A	1.910	1.00
73_D	88_P	1.891	1.00
24_L	108_R	1.818	1.00
34_N	106_K	1.772	1.00
58_T	78_E	1.718	1.00
12_K	15_G	1.706	1.00
35_I	105_H	1.624	1.00
39_H	101_V	1.618	1.00
66_F	91_I	1.510	1.00
67_F	96_L	1.492	1.00
37_L	101_V	1.482	1.00
8_T	130_R	1.480	1.00
18_L	116_G	1.477	1.00
54_N	116_G	1.475	1.00
14_R	88_P	1.471	1.00
58_T	81_Y	1.468	1.00
25_N	29_D	1.449	1.00
66_F	70_T	1.362	1.00
33_V	104_V	1.315	1.00
74_N	84_A	1.297	1.00
6_T	43_Q	1.294	1.00
93_S	98_T	1.277	1.00
68_L	73_D	1.260	1.00
39_H	134_T	1.257	1.00
71_V	95_M	1.252	1.00
16_F	120_G	1.238	1.00
64_E	68_L	1.234	1.00
104_V	135_L	1.224	1.00
69_R	75_G	1.220	1.00
63_M	94_S	1.219	1.00
10_S	128_S	1.212	1.00
24_L	109_I	1.210	1.00
23_I	38_L	1.209	1.00
48_S	96_L	1.205	1.00
41_L	51_L	1.198	1.00
31_P	135_L	1.198	1.00
38_L	109_I	1.188	1.00
5_K	26_Q	1.134	1.00
43_Q	132_I	1.131	1.00
61_H	65_R	1.125	1.00
10_S	22_E	1.115	1.00
51_L	102_L	1.111	1.00
19_V	131_I	1.109	1.00
66_F	77_Y	1.100	1.00
7_L	131_I	1.096	1.00
16_F	67_F	1.084	0.99
27_L	135_L	1.063	0.99
14_R	73_D	1.056	0.99
66_F	69_R	1.048	0.99
26_Q	135_L	1.019	0.99
27_L	104_V	0.999	0.99
66_F	75_G	0.995	0.99
66_F	71_V	0.986	0.99
21_D	25_N	0.983	0.99
43_Q	110_Q	0.982	0.99
103_P	134_T	0.974	0.99
71_V	77_Y	0.974	0.99
47_A	119_L	0.970	0.99
102_L	117_I	0.960	0.99
65_R	69_R	0.947	0.99
37_L	136_Q	0.945	0.99
6_T	105_H	0.937	0.98
27_L	31_P	0.933	0.98
72_P	75_G	0.931	0.98
67_F	120_G	0.917	0.98
42_L	93_S	0.909	0.98
19_V	23_I	0.907	0.98
58_T	61_H	0.893	0.98
24_L	28_A	0.892	0.98
96_L	122_H	0.891	0.98
76_N	80_D	0.881	0.98
25_N	28_A	0.876	0.98
28_A	108_R	0.874	0.98
55_C	118_W	0.865	0.97
40_L	100_L	0.851	0.97
21_D	24_L	0.837	0.97
65_R	75_G	0.828	0.97
71_V	91_I	0.828	0.97
110_Q	132_I	0.827	0.97
73_D	92_K	0.820	0.97
50_T	120_G	0.805	0.96
16_F	118_W	0.802	0.96
27_L	109_I	0.794	0.96
77_Y	80_D	0.793	0.96
12_K	22_E	0.787	0.96
38_L	104_V	0.780	0.95
42_L	49_L	0.773	0.95
9_L	17_H	0.771	0.95
26_Q	31_P	0.770	0.95
51_L	111_T	0.770	0.95
50_T	97_G	0.769	0.95
73_D	77_Y	0.767	0.95
41_L	103_P	0.762	0.95
102_L	109_I	0.757	0.95
41_L	102_L	0.757	0.95
60_R	64_E	0.753	0.94
49_L	100_L	0.752	0.94
51_L	98_T	0.749	0.94
53_E	114_W	0.746	0.94
38_L	135_L	0.744	0.94
79_H	82_E	0.739	0.94
35_I	134_T	0.738	0.94
73_D	124_I	0.736	0.94
6_T	110_Q	0.732	0.94
35_I	106_K	0.729	0.93
82_E	85_D	0.728	0.93
39_H	103_P	0.726	0.93
54_N	118_W	0.724	0.93
28_A	32_R	0.715	0.93
23_I	40_L	0.711	0.93
68_L	92_K	0.709	0.92
65_R	76_N	0.700	0.92
124_I	127_G	0.698	0.92
42_L	119_L	0.693	0.92
103_P	132_I	0.684	0.91
34_N	107_G	0.671	0.90
46_S	86_D	0.667	0.90
37_L	134_T	0.665	0.90
55_C	59_V	0.653	0.89
9_L	22_E	0.647	0.89
7_L	26_Q	0.642	0.88
41_L	99_S	0.641	0.88
39_H	99_S	0.641	0.88
22_E	26_Q	0.639	0.88
16_F	63_M	0.639	0.88
58_T	116_G	0.637	0.88
87_M	91_I	0.623	0.87
48_S	100_L	0.618	0.86
40_L	49_L	0.602	0.85
21_D	108_R	0.599	0.84
55_C	113_T	0.597	0.84
48_S	120_G	0.592	0.84
35_I	104_V	0.591	0.84
82_E	86_D	0.591	0.84
94_S	97_G	0.588	0.83
63_M	91_I	0.585	0.83
11_A	127_G	0.585	0.83
21_D	28_A	0.581	0.83
77_Y	91_I	0.575	0.82
83_G	87_M	0.574	0.82
16_F	60_R	0.569	0.81
85_D	122_H	0.567	0.81
33_V	36_G	0.566	0.81
52_N	118_W	0.564	0.81
14_R	64_E	0.562	0.81
53_E	59_V	0.561	0.80
24_L	27_L	0.557	0.80
23_I	26_Q	0.557	0.80
35_I	136_Q	0.557	0.80
80_D	84_A	0.555	0.80
15_G	121_E	0.549	0.79
44_H	52_N	0.544	0.78
53_E	129_R	0.544	0.78
26_Q	29_D	0.543	0.78
49_L	117_I	0.540	0.78
92_K	120_G	0.540	0.78
16_F	50_T	0.536	0.77
16_F	52_N	0.535	0.77
44_H	90_H	0.532	0.77
110_Q	134_T	0.531	0.77
67_F	95_M	0.530	0.77
21_D	34_N	0.524	0.76
18_L	54_N	0.523	0.76
89_S	92_K	0.519	0.75
41_L	100_L	0.517	0.75
54_N	60_R	0.514	0.74
52_N	63_M	0.513	0.74
55_C	80_D	0.512	0.74
59_V	87_M	0.512	0.74
46_S	82_E	0.512	0.74
119_L	131_I	0.508	0.74
67_F	72_P	0.507	0.73
60_R	71_V	0.506	0.73
105_H	134_T	0.505	0.73
6_T	132_I	0.505	0.73
11_A	128_S	0.505	0.73
51_L	118_W	0.501	0.73
27_L	33_V	0.500	0.72

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2p6cA	3	0.9783	100	0.079	Contact Map
2p6hA	3	0.9638	100	0.087	Contact Map
1vphA	4	0.971	100	0.091	Contact Map
1vmjA	4	0.9783	100	0.096	Contact Map
1ve0A	3	0.9565	100	0.098	Contact Map
1vmhA	3	0.9275	100	0.138	Contact Map
1vmfA	3	0.9638	100	0.141	Contact Map
2cu5A	3	0.9275	100	0.15	Contact Map
2w1iA	1	0.2391	8.4	0.951	Contact Map
1mzrA	1	0.2536	8.3	0.951	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.