MOG - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MOG - Molybdopterin adenylyltransferase

UniProt:	P0AF03	Sequences: MNTLRIGLVSISDRASSGVYQDKGIPALEEWLTSALTTPFELETRLIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMRQISLHFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLEGPYVETAPEVVAAFRPKSARRDVSE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11511
Length:	195 (152)
Sequences:	4674 (3150)
Seq/√Len:	255.5

ECOLI - MOG MOAB MOEA
BACSU - MOAB MOEA
HALSA - Q9HP37 Q9HST2 Q9HST3
SULSO - Q981C6 Q7LXN4 Q97W71

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_G	67_C	3.986	1.00
106_I	109_H	3.104	1.00
32_L	37_T	2.956	1.00
89_L	95_E	2.910	1.00
88_T	131_N	2.844	1.00
13_D	81_R	2.565	1.00
51_Q	90_A	2.435	1.00
101_E	104_R	2.329	1.00
9_V	61_L	2.027	1.00
78_P	96_M	1.969	1.00
92_A	122_V	1.964	1.00
29_E	44_T	1.933	1.00
8_L	29_E	1.921	1.00
50_E	53_I	1.907	1.00
29_E	33_T	1.904	1.00
6_I	32_L	1.886	1.00
51_Q	55_E	1.871	1.00
27_A	140_K	1.812	1.00
55_E	59_C	1.809	1.00
55_E	90_A	1.791	1.00
15_A	20_Y	1.749	1.00
10_S	73_T	1.744	1.00
45_R	57_T	1.731	1.00
7_G	61_L	1.731	1.00
24_G	73_T	1.723	1.00
31_W	144_E	1.671	1.00
11_I	47_I	1.671	1.00
14_R	20_Y	1.637	1.00
42_L	67_C	1.581	1.00
48_P	53_I	1.579	1.00
57_T	60_E	1.575	1.00
28_L	143_L	1.551	1.00
137_K	141_E	1.547	1.00
23_K	136_P	1.528	1.00
102_Q	105_Q	1.501	1.00
5_R	38_T	1.496	1.00
103_M	142_T	1.489	1.00
57_T	61_L	1.453	1.00
11_I	54_I	1.451	1.00
31_W	143_L	1.406	1.00
55_E	94_R	1.401	1.00
130_L	149_A	1.389	1.00
16_S	19_V	1.384	1.00
50_E	54_I	1.303	1.00
62_V	127_A	1.302	1.00
69_L	130_L	1.277	1.00
68_H	158_I	1.270	1.00
69_L	150_E	1.251	1.00
63_D	124_R	1.242	1.00
147_K	151_G	1.241	1.00
51_Q	83_V	1.221	1.00
100_G	121_G	1.213	1.00
93_D	125_K	1.202	1.00
123_I	157_G	1.199	1.00
107_S	142_T	1.177	1.00
38_T	42_L	1.176	1.00
102_Q	115_I	1.172	1.00
71_L	132_L	1.171	1.00
3_T	38_T	1.171	1.00
72_T	129_I	1.168	1.00
62_V	124_R	1.166	1.00
105_Q	146_V	1.164	1.00
10_S	25_I	1.151	1.00
92_A	120_V	1.144	1.00
35_A	147_K	1.143	1.00
27_A	30_E	1.132	1.00
53_I	57_T	1.125	1.00
52_A	56_Q	1.112	1.00
5_R	42_L	1.109	1.00
26_P	44_T	1.099	1.00
31_W	35_A	1.094	1.00
70_V	127_A	1.088	1.00
52_A	55_E	1.079	1.00
92_A	95_E	1.076	1.00
27_A	139_I	1.052	1.00
53_I	56_Q	1.038	1.00
115_I	130_L	1.017	1.00
61_L	67_C	1.013	1.00
99_F	117_S	1.005	1.00
9_V	57_T	1.003	1.00
94_R	123_I	0.996	1.00
45_R	60_E	0.995	1.00
88_T	92_A	0.993	1.00
54_I	83_V	0.982	1.00
124_R	129_I	0.975	1.00
30_E	34_S	0.968	1.00
27_A	136_P	0.966	1.00
105_Q	109_H	0.957	1.00
32_L	71_L	0.957	1.00
62_V	70_V	0.954	1.00
47_I	57_T	0.942	1.00
9_V	45_R	0.942	1.00
32_L	143_L	0.940	1.00
72_T	131_N	0.933	1.00
51_Q	54_I	0.902	1.00
140_K	144_E	0.895	1.00
151_G	156_H	0.893	1.00
28_L	139_I	0.892	1.00
132_L	142_T	0.892	1.00
89_L	120_V	0.887	1.00
38_T	41_E	0.872	1.00
51_Q	91_V	0.871	1.00
101_E	117_S	0.871	1.00
14_R	19_V	0.870	1.00
71_L	143_L	0.868	1.00
50_E	83_V	0.866	1.00
114_A	131_N	0.862	1.00
54_I	58_L	0.849	0.99
28_L	73_T	0.846	0.99
95_E	100_G	0.841	0.99
106_I	145_G	0.838	0.99
56_Q	60_E	0.834	0.99
111_V	138_S	0.832	0.99
5_R	68_H	0.831	0.99
144_E	147_K	0.829	0.99
9_V	70_V	0.829	0.99
44_T	61_L	0.828	0.99
107_S	146_V	0.826	0.99
7_G	44_T	0.818	0.99
10_S	24_G	0.816	0.99
63_D	66_S	0.816	0.99
4_L	154_V	0.811	0.99
60_E	66_S	0.810	0.99
58_L	70_V	0.797	0.99
10_S	22_D	0.793	0.99
92_A	129_I	0.792	0.99
28_L	132_L	0.790	0.99
8_L	25_I	0.790	0.99
143_L	147_K	0.788	0.99
113_T	142_T	0.777	0.99
9_V	47_I	0.763	0.99
156_H	159_F	0.762	0.99
35_A	143_L	0.760	0.99
133_P	138_S	0.758	0.99
44_T	66_S	0.743	0.99
6_I	37_T	0.735	0.98
80_R	126_Q	0.723	0.98
99_F	121_G	0.719	0.98
7_G	43_E	0.713	0.98
96_M	100_G	0.713	0.98
59_C	63_D	0.713	0.98
37_T	41_E	0.711	0.98
130_L	146_V	0.707	0.98
128_L	153_V	0.707	0.98
32_L	41_E	0.703	0.98
22_D	46_L	0.703	0.98
110_F	141_E	0.701	0.98
31_W	147_K	0.700	0.98
115_I	149_A	0.698	0.98
49_D	134_G	0.698	0.98
13_D	48_P	0.685	0.98
78_P	123_I	0.684	0.97
8_L	41_E	0.681	0.97
25_I	43_E	0.678	0.97
59_C	62_V	0.677	0.97
4_L	37_T	0.675	0.97
59_C	124_R	0.672	0.97
4_L	155_V	0.671	0.97
108_L	142_T	0.665	0.97
144_E	161_S	0.663	0.97
30_E	33_T	0.661	0.97
24_G	28_L	0.653	0.97
9_V	54_I	0.645	0.96
63_D	125_K	0.642	0.96
58_L	72_T	0.636	0.96
70_V	129_I	0.634	0.96
106_I	110_F	0.631	0.96
28_L	71_L	0.629	0.96
117_S	128_L	0.622	0.96
76_T	80_R	0.611	0.95
26_P	30_E	0.610	0.95
67_C	70_V	0.608	0.95
152_N	159_F	0.606	0.95
105_Q	108_L	0.605	0.95
60_E	63_D	0.604	0.95
96_M	99_F	0.604	0.95
107_S	114_A	0.602	0.95
76_T	104_R	0.600	0.95
89_L	92_A	0.597	0.95
112_P	149_A	0.595	0.94
10_S	44_T	0.591	0.94
103_M	114_A	0.590	0.94
59_C	95_E	0.589	0.94
22_D	26_P	0.588	0.94
132_L	143_L	0.587	0.94
25_I	44_T	0.585	0.94
88_T	91_V	0.584	0.94
136_P	140_K	0.582	0.94
22_D	25_I	0.579	0.94
10_S	45_R	0.576	0.93
49_D	82_D	0.576	0.93
78_P	153_V	0.571	0.93
8_L	32_L	0.565	0.93
55_E	91_V	0.556	0.92
69_L	154_V	0.552	0.92
11_I	58_L	0.550	0.92
98_G	118_R	0.550	0.92
68_H	127_A	0.549	0.92
98_G	116_L	0.548	0.92
33_T	36_L	0.547	0.92
159_F	162_V	0.547	0.92
142_T	146_V	0.546	0.92
23_K	26_P	0.545	0.91
42_L	66_S	0.545	0.91
76_T	81_R	0.543	0.91
102_Q	106_I	0.540	0.91
29_E	43_E	0.539	0.91
102_Q	108_L	0.539	0.91
82_D	111_V	0.538	0.91
108_L	111_V	0.537	0.91
99_F	115_I	0.536	0.91
61_L	70_V	0.534	0.91
155_V	160_A	0.531	0.90
8_L	28_L	0.530	0.90
17_S	26_P	0.529	0.90
31_W	140_K	0.528	0.90
69_L	128_L	0.528	0.90
103_M	138_S	0.527	0.90
82_D	134_G	0.525	0.90
31_W	139_I	0.522	0.90
49_D	75_G	0.521	0.90
118_R	128_L	0.520	0.89
151_G	154_V	0.516	0.89
156_H	161_S	0.514	0.89
24_G	136_P	0.513	0.89
92_A	98_G	0.510	0.89
103_M	146_V	0.500	0.88
116_L	153_V	0.500	0.88

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jljA	3	0.8359	100	0.306	Contact Map
1di6A	3	0.8718	100	0.312	Contact Map
4nwoA	3	0.8769	100	0.319	Contact Map
1g8lA	2	0.9179	100	0.32	Contact Map
4xcwA	3	0.9026	100	0.321	Contact Map
4pd0A	2	0.9333	100	0.322	Contact Map
3rfqA	5	0.7897	100	0.324	Contact Map
1uz5A	1	0.8718	100	0.329	Contact Map
2pbqA	3	0.8923	100	0.333	Contact Map
3pzyA	3	0.7641	100	0.333	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.