MARC - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MARC - UPF0056 inner membrane protein MarC

UniProt:	P0AEY1	Sequences: MLDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSLMASVYVFAIMMVAYYAGQLVMDTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAIDSPEAKSKSEELEDEPSANIAFVPLAMPSTAGPGTIAMIISSASTVRQSSTFADWVLMVAPPLIFFLVAVILWGSLRSSGAIMRLVGKGGIEAISRLMGFLLVCMGVQFIINGILEIIKTYH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11637
Length:	221 (196)
Sequences:	2513 (1660)
Seq/√Len:	118.6

ECOLI - MARC YCHE YHGN
BACSU - YVBG
SULSO - Q7LXS5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
210_I	216_I	4.162	1.00
36_N	39_E	3.359	1.00
52_F	168_A	3.251	1.00
55_M	134_T	3.205	1.00
78_I	210_I	3.104	1.00
86_F	89_F	2.939	1.00
75_G	207_Q	2.861	1.00
172_W	176_R	2.693	1.00
74_P	215_E	2.663	1.00
45_L	172_W	2.594	1.00
12_L	166_L	2.582	1.00
207_Q	211_N	2.431	1.00
50_Y	121_F	2.389	1.00
54_I	126_M	2.229	1.00
63_Q	67_D	2.147	1.00
186_G	189_G	2.140	1.00
52_F	165_F	2.111	1.00
85_A	209_I	1.997	1.00
11_G	163_I	1.973	1.00
48_S	168_A	1.972	1.00
49_V	53_A	1.950	1.00
28_F	32_A	1.914	1.00
8_I	162_L	1.863	1.00
8_I	163_I	1.859	1.00
56_M	161_P	1.835	1.00
12_L	170_I	1.834	1.00
90_R	95_Q	1.781	1.00
51_V	168_A	1.771	1.00
41_N	176_R	1.762	1.00
60_Y	161_P	1.749	1.00
88_G	202_V	1.727	1.00
19_A	167_V	1.704	1.00
52_F	56_M	1.657	1.00
74_P	77_R	1.629	1.00
214_L	217_I	1.608	1.00
180_A	183_R	1.600	1.00
78_I	216_I	1.594	1.00
142_A	157_M	1.589	1.00
20_N	23_T	1.586	1.00
50_Y	125_A	1.579	1.00
82_L	85_A	1.537	1.00
82_L	209_I	1.505	1.00
55_M	130_A	1.498	1.00
77_R	211_N	1.486	1.00
11_G	141_S	1.470	1.00
15_L	138_I	1.442	1.00
85_A	205_G	1.430	1.00
54_I	130_A	1.390	1.00
28_F	44_S	1.387	1.00
56_M	165_F	1.371	1.00
55_M	138_I	1.364	1.00
40_R	179_G	1.351	1.00
142_A	160_P	1.337	1.00
48_S	171_L	1.333	1.00
59_Y	138_I	1.314	1.00
45_L	176_R	1.293	1.00
28_F	124_L	1.285	1.00
42_R	46_M	1.265	0.99
129_T	171_L	1.254	0.99
75_G	210_I	1.252	0.99
35_M	39_E	1.249	0.99
37_S	41_N	1.248	0.99
23_T	26_A	1.241	0.99
169_V	173_G	1.235	0.99
91_M	198_G	1.233	0.99
81_G	209_I	1.233	0.99
48_S	172_W	1.232	0.99
8_I	12_L	1.219	0.99
177_S	180_A	1.195	0.99
59_Y	161_P	1.188	0.99
153_D	156_L	1.186	0.99
155_V	158_V	1.183	0.99
24_T	175_L	1.175	0.99
138_I	164_F	1.175	0.99
53_A	57_V	1.164	0.99
120_A	125_A	1.163	0.99
15_L	164_F	1.162	0.99
19_A	168_A	1.157	0.99
46_M	118_N	1.156	0.99
201_L	205_G	1.145	0.99
17_P	69_F	1.142	0.99
91_M	197_M	1.139	0.99
81_G	212_G	1.136	0.99
8_I	166_L	1.132	0.99
59_Y	142_A	1.125	0.99
210_I	213_I	1.112	0.99
72_S	207_Q	1.111	0.99
35_M	43_Q	1.110	0.99
77_R	215_E	1.103	0.99
61_A	65_V	1.096	0.98
180_A	184_L	1.091	0.98
19_A	134_T	1.088	0.98
78_I	213_I	1.070	0.98
47_A	51_V	1.064	0.98
134_T	138_I	1.064	0.98
185_V	189_G	1.059	0.98
32_A	40_R	1.056	0.98
17_P	20_N	1.056	0.98
37_S	40_R	1.056	0.98
82_L	89_F	1.048	0.98
78_I	209_I	1.040	0.98
20_N	84_V	1.037	0.98
41_N	45_L	1.024	0.98
26_A	29_L	1.024	0.98
54_I	125_A	1.006	0.97
28_F	40_R	1.006	0.97
45_L	49_V	1.004	0.97
91_M	194_S	1.002	0.97
83_I	202_V	0.999	0.97
173_G	177_S	0.986	0.97
85_A	202_V	0.979	0.97
66_M	203_C	0.977	0.97
18_L	133_G	0.972	0.97
51_V	125_A	0.971	0.97
202_V	205_G	0.967	0.97
85_A	89_F	0.965	0.97
158_V	162_L	0.963	0.97
55_M	135_I	0.954	0.96
59_Y	157_M	0.951	0.96
18_L	137_M	0.948	0.96
83_I	87_I	0.944	0.96
29_L	182_M	0.939	0.96
159_A	162_L	0.937	0.96
78_I	212_G	0.923	0.96
57_V	61_A	0.920	0.96
16_L	170_I	0.919	0.96
157_M	161_P	0.918	0.95
23_T	27_L	0.904	0.95
96_Q	99_I	0.897	0.95
112_E	116_S	0.889	0.95
65_V	135_I	0.885	0.95
37_S	179_G	0.877	0.94
50_Y	120_A	0.862	0.94
28_F	178_S	0.861	0.94
135_I	139_I	0.834	0.93
14_V	137_M	0.822	0.92
79_A	206_V	0.820	0.92
114_E	217_I	0.819	0.92
53_A	154_W	0.810	0.91
92_L	198_G	0.805	0.91
112_E	173_G	0.803	0.91
121_F	188_G	0.802	0.91
64_L	67_D	0.799	0.91
23_T	171_L	0.793	0.91
163_I	167_V	0.788	0.90
167_V	170_I	0.787	0.90
47_A	119_I	0.783	0.90
169_V	180_A	0.773	0.89
130_A	164_F	0.771	0.89
67_D	158_V	0.765	0.89
24_T	128_S	0.763	0.89
72_S	75_G	0.761	0.89
16_L	174_S	0.759	0.89
195_R	206_V	0.753	0.88
20_N	197_M	0.748	0.88
48_S	51_V	0.747	0.88
78_I	206_V	0.746	0.88
39_E	43_Q	0.740	0.87
83_I	190_I	0.738	0.87
113_D	116_S	0.737	0.87
15_L	55_M	0.735	0.87
76_L	137_M	0.733	0.87
55_M	164_F	0.731	0.87
125_A	130_A	0.727	0.86
76_L	168_A	0.726	0.86
46_M	50_Y	0.720	0.86
25_V	175_L	0.720	0.86
20_N	26_A	0.713	0.85
28_F	132_P	0.712	0.85
84_V	140_S	0.706	0.85
188_G	192_A	0.706	0.85
61_A	64_L	0.701	0.84
44_S	193_I	0.695	0.84
90_R	93_F	0.693	0.84
7_A	145_V	0.691	0.83
25_V	174_S	0.689	0.83
20_N	58_A	0.689	0.83
130_A	198_G	0.689	0.83
66_M	139_I	0.688	0.83
39_E	42_R	0.682	0.83
24_T	129_T	0.682	0.83
21_P	167_V	0.678	0.82
90_R	99_I	0.677	0.82
43_Q	120_A	0.665	0.81
76_L	136_A	0.663	0.81
21_P	132_P	0.662	0.81
113_D	187_K	0.661	0.81
71_I	97_K	0.659	0.81
80_G	136_A	0.656	0.80
94_P	198_G	0.655	0.80
46_M	120_A	0.653	0.80
25_V	29_L	0.651	0.80
58_A	139_I	0.649	0.79
41_N	172_W	0.644	0.79
66_M	80_G	0.640	0.79
14_V	199_F	0.640	0.79
112_E	187_K	0.640	0.79
53_A	114_E	0.638	0.78
20_N	134_T	0.637	0.78
17_P	202_V	0.636	0.78
28_F	72_S	0.635	0.78
16_L	167_V	0.633	0.78
74_P	210_I	0.633	0.78
7_A	159_A	0.629	0.77
118_N	213_I	0.629	0.77
12_L	16_L	0.627	0.77
88_G	191_E	0.627	0.77
134_T	164_F	0.626	0.77
75_G	79_A	0.626	0.77
120_A	124_L	0.625	0.77
24_T	83_I	0.622	0.77
17_P	199_F	0.620	0.76
54_I	177_S	0.619	0.76
146_R	159_A	0.617	0.76
196_L	200_L	0.615	0.76
94_P	195_R	0.612	0.75
111_L	117_A	0.611	0.75
69_F	140_S	0.608	0.75
166_L	184_L	0.606	0.75
213_I	217_I	0.606	0.75
141_S	160_P	0.604	0.74
22_L	193_I	0.603	0.74
59_Y	196_L	0.600	0.74
20_N	79_A	0.598	0.74
66_M	72_S	0.597	0.74
83_I	128_S	0.593	0.73
133_G	201_L	0.593	0.73
197_M	208_F	0.590	0.73
18_L	204_M	0.589	0.73
80_G	91_M	0.589	0.73
18_L	54_I	0.588	0.73
155_V	184_L	0.588	0.73
94_P	191_E	0.587	0.72
158_V	161_P	0.586	0.72
83_I	138_I	0.586	0.72
14_V	18_L	0.585	0.72
187_K	191_E	0.583	0.72
126_M	199_F	0.581	0.72
88_G	92_L	0.579	0.71
133_G	195_R	0.579	0.71
22_L	66_M	0.578	0.71
61_A	140_S	0.577	0.71
38_A	184_L	0.576	0.71
84_V	204_M	0.574	0.71
76_L	199_F	0.574	0.71
88_G	205_G	0.572	0.70
6_K	61_A	0.566	0.70
69_F	205_G	0.564	0.69
32_A	35_M	0.562	0.69
162_L	166_L	0.562	0.69
146_R	154_W	0.561	0.69
184_L	187_K	0.561	0.69
62_G	131_G	0.560	0.69
122_V	201_L	0.560	0.69
17_P	74_P	0.558	0.69
128_S	131_G	0.558	0.69
136_A	139_I	0.558	0.69
47_A	125_A	0.557	0.68
68_T	204_M	0.553	0.68
75_G	216_I	0.552	0.68
20_N	85_A	0.551	0.68
38_A	41_N	0.548	0.67
16_L	90_R	0.545	0.67
155_V	173_G	0.544	0.67
59_Y	164_F	0.544	0.67
126_M	200_L	0.539	0.66
159_A	163_I	0.538	0.66
167_V	171_L	0.538	0.66
156_L	159_A	0.538	0.66
193_I	217_I	0.538	0.66
73_I	88_G	0.535	0.65
181_I	185_V	0.532	0.65
22_L	197_M	0.529	0.64
24_T	124_L	0.527	0.64
43_Q	47_A	0.525	0.64
12_L	163_I	0.522	0.63
46_M	168_A	0.522	0.63
64_L	196_L	0.522	0.63
15_L	19_A	0.519	0.63
162_L	184_L	0.517	0.63
53_A	157_M	0.517	0.63
92_L	205_G	0.516	0.63
94_P	201_L	0.515	0.62
26_A	128_S	0.514	0.62
26_A	129_T	0.512	0.62
192_A	196_L	0.511	0.62
58_A	129_T	0.511	0.62
71_I	114_E	0.508	0.61
119_I	124_L	0.505	0.61
31_L	119_I	0.505	0.61
110_E	114_E	0.501	0.60
57_V	96_Q	0.501	0.60
79_A	122_V	0.500	0.60
7_A	14_V	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4w6vA	1	0.4389	33.2	0.943	Contact Map
4c7rA	3	0.4525	15	0.951	Contact Map
2cfqA	1	0.4842	13.8	0.952	Contact Map
3w9iA	3	0.9095	13.8	0.952	Contact Map
4ldsA	2	0.4434	11.4	0.954	Contact Map
4k0jA	3	0.7059	10.9	0.954	Contact Map
4zw9A	1	0.5023	9.9	0.955	Contact Map
4j05A	3	0.5023	9.5	0.955	Contact Map
4pypA	1	0.4299	9.4	0.955	Contact Map
3aqpA	1	0.8733	9.1	0.956	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.