GLCG - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GLCG - Protein GlcG

UniProt:	P0AEQ1	Sequences: MKTKVILSQQMASAIIAAGQEEAQKNNWSVSIAVADDGGHLLALSRMDDCAPIAAYISQEKARTAALGRRETKGYEEMVNNGRTAFVTAPLLTSLEGGVPVVVDGQIIGAVGVSGLTGAQDAQVAKAAAAVLAK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12952
Length:	134 (126)
Sequences:	2379 (1555)
Seq/√Len:	138.5

ECOLI - GLCG
SULSO - Q97YT3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_E	25_K	3.660	1.00
16_I	43_A	3.470	1.00
13_S	45_S	2.822	1.00
33_A	58_S	2.802	1.00
31_S	44_L	2.204	1.00
73_K	122_A	2.195	1.00
126_K	130_A	2.156	1.00
22_E	26_N	2.104	1.00
33_A	41_L	2.024	1.00
33_A	44_L	1.969	1.00
22_E	123_Q	1.945	1.00
41_L	44_L	1.916	1.00
30_V	124_V	1.911	1.00
116_L	120_Q	1.899	1.00
101_V	129_A	1.881	1.00
63_R	91_L	1.811	1.00
71_E	100_P	1.775	1.00
13_S	20_Q	1.738	1.00
15_I	128_A	1.734	1.00
102_V	107_I	1.670	1.00
35_A	110_A	1.614	1.00
7_L	42_L	1.595	1.00
60_E	91_L	1.565	1.00
33_A	59_Q	1.563	1.00
96_E	122_A	1.545	1.00
19_G	128_A	1.473	1.00
57_I	114_S	1.444	1.00
113_V	125_A	1.437	1.00
12_A	43_A	1.430	1.00
24_Q	47_M	1.414	1.00
15_I	101_V	1.363	1.00
20_Q	45_S	1.341	1.00
31_S	54_A	1.339	1.00
99_V	122_A	1.313	1.00
9_Q	45_S	1.279	1.00
44_L	55_A	1.245	1.00
95_L	118_G	1.239	1.00
63_R	67_L	1.228	1.00
56_Y	59_Q	1.222	1.00
53_I	68_G	1.221	1.00
13_S	17_A	1.216	1.00
18_A	131_V	1.214	1.00
19_G	32_I	1.210	1.00
20_Q	32_I	1.207	1.00
68_G	75_Y	1.199	1.00
72_T	98_G	1.199	1.00
19_G	111_V	1.179	1.00
23_A	30_V	1.173	0.99
8_S	11_M	1.170	0.99
26_N	123_Q	1.157	0.99
15_I	111_V	1.155	0.99
21_E	25_K	1.154	0.99
28_W	116_L	1.136	0.99
73_K	96_E	1.134	0.99
101_V	109_G	1.124	0.99
117_T	120_Q	1.085	0.99
122_A	126_K	1.082	0.99
29_S	49_D	1.081	0.99
23_A	124_V	1.072	0.99
17_A	21_E	1.045	0.99
11_M	103_V	1.038	0.99
9_Q	12_A	1.037	0.99
16_I	34_V	1.033	0.99
60_E	93_T	1.030	0.99
74_G	77_E	1.027	0.99
20_Q	24_Q	1.018	0.99
36_D	46_R	1.012	0.98
6_I	37_D	1.006	0.98
50_C	54_A	1.001	0.98
19_G	113_V	0.991	0.98
81_N	86_F	0.989	0.98
53_I	67_L	0.987	0.98
31_S	50_C	0.985	0.98
30_V	116_L	0.984	0.98
49_D	106_Q	0.972	0.98
9_Q	13_S	0.967	0.98
42_L	48_D	0.959	0.98
38_G	46_R	0.953	0.98
30_V	113_V	0.953	0.98
16_I	45_S	0.949	0.98
103_V	108_I	0.946	0.98
17_A	45_S	0.932	0.97
41_L	59_Q	0.931	0.97
79_V	86_F	0.928	0.97
23_A	47_M	0.925	0.97
19_G	124_V	0.919	0.97
22_E	127_A	0.918	0.97
40_H	52_P	0.911	0.97
76_E	79_V	0.910	0.97
44_L	59_Q	0.906	0.97
18_A	21_E	0.906	0.97
127_A	130_A	0.904	0.97
56_Y	60_E	0.877	0.96
12_A	34_V	0.872	0.96
102_V	105_G	0.865	0.96
99_V	126_K	0.860	0.96
30_V	115_G	0.848	0.96
57_I	93_T	0.834	0.95
26_N	120_Q	0.827	0.95
120_Q	123_Q	0.816	0.94
18_A	128_A	0.798	0.94
96_E	118_G	0.794	0.94
73_K	77_E	0.782	0.93
34_V	43_A	0.776	0.93
35_A	62_A	0.772	0.93
14_A	17_A	0.770	0.93
99_V	129_A	0.760	0.92
28_W	120_Q	0.757	0.92
60_E	89_A	0.756	0.92
65_A	72_T	0.756	0.92
66_A	110_A	0.751	0.92
31_S	55_A	0.750	0.92
10_Q	24_Q	0.743	0.91
35_A	66_A	0.736	0.91
77_E	81_N	0.733	0.91
111_V	129_A	0.727	0.90
10_Q	14_A	0.725	0.90
66_A	69_R	0.724	0.90
51_A	54_A	0.723	0.90
21_E	24_Q	0.720	0.90
14_A	18_A	0.715	0.90
41_L	55_A	0.714	0.89
71_E	99_V	0.712	0.89
15_I	129_A	0.712	0.89
55_A	59_Q	0.707	0.89
20_Q	47_M	0.705	0.89
56_Y	89_A	0.704	0.89
52_P	67_L	0.700	0.89
7_L	101_V	0.697	0.88
127_A	131_V	0.694	0.88
75_Y	79_V	0.689	0.88
18_A	127_A	0.687	0.88
119_A	123_Q	0.677	0.87
12_A	42_L	0.675	0.87
72_T	94_S	0.674	0.87
111_V	128_A	0.673	0.87
110_A	129_A	0.663	0.86
11_M	14_A	0.658	0.85
68_G	92_L	0.658	0.85
77_E	80_N	0.648	0.84
76_E	80_N	0.647	0.84
69_R	107_I	0.644	0.84
32_I	124_V	0.643	0.84
14_A	131_V	0.642	0.84
32_I	111_V	0.640	0.84
10_Q	17_A	0.634	0.83
7_L	37_D	0.631	0.83
85_A	118_G	0.625	0.82
88_T	94_S	0.624	0.82
29_S	116_L	0.622	0.82
64_T	72_T	0.614	0.81
50_C	91_L	0.608	0.81
44_L	58_S	0.608	0.81
99_V	125_A	0.607	0.80
26_N	124_V	0.603	0.80
15_I	18_A	0.600	0.80
8_S	42_L	0.593	0.79
53_I	57_I	0.593	0.79
100_P	107_I	0.587	0.78
71_E	126_K	0.586	0.78
64_T	92_L	0.580	0.77
38_G	66_A	0.577	0.77
7_L	11_M	0.575	0.77
67_L	88_T	0.574	0.77
79_V	82_G	0.568	0.76
56_Y	91_L	0.566	0.76
81_N	94_S	0.560	0.75
98_G	125_A	0.555	0.74
13_S	43_A	0.552	0.74
42_L	46_R	0.550	0.74
82_G	86_F	0.548	0.73
53_I	88_T	0.545	0.73
9_Q	48_D	0.544	0.73
51_A	118_G	0.541	0.72
96_E	116_L	0.533	0.71
60_E	88_T	0.529	0.71
113_V	128_A	0.528	0.71
70_R	74_G	0.520	0.69
16_I	32_I	0.519	0.69
68_G	89_A	0.517	0.69
124_V	127_A	0.516	0.69
76_E	92_L	0.515	0.69
31_S	115_G	0.514	0.69
79_V	90_P	0.513	0.68
81_N	118_G	0.510	0.68
26_N	116_L	0.508	0.68
55_A	58_S	0.504	0.67
24_Q	37_D	0.504	0.67
75_Y	94_S	0.500	0.66

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4nkpA	5	1	100	0.164	Contact Map
2a2lA	5	1	100	0.17	Contact Map
3fpwA	5	0.9776	100	0.175	Contact Map
4clcA	5	0.9925	100	0.217	Contact Map
3mq0A	2	0.9478	88.4	0.878	Contact Map
2ia2A	4	0.9552	86.8	0.881	Contact Map
2o0yA	4	0.9552	86.4	0.882	Contact Map
1yspA	1	0.8806	85.9	0.883	Contact Map
1mkmA	4	0.9552	83.7	0.886	Contact Map
2o99A	2	0.9254	83.3	0.887	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.