FEOA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FEOA - Ferrous iron transport protein A

UniProt:	P0AEL3	Sequences: MQYTPDTAWKITGFSREISPAYRQKLLSLGMLPGSSFNVVRVAPLGDPIHIETRRVSLVLRKKDLALLEVEAVSC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12101
Length:	75 (66)
Sequences:	334 (248)
Seq/√Len:	30.6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_A	36_S	2.743	1.00
55_R	65_L	2.157	0.98
31_M	38_N	2.107	0.98
47_D	61_R	1.855	0.96
32_L	54_R	1.805	0.95
48_P	61_R	1.805	0.95
43_A	61_R	1.701	0.93
4_T	7_T	1.640	0.92
44_P	47_D	1.640	0.92
9_W	65_L	1.625	0.91
4_T	70_V	1.622	0.91
10_K	36_S	1.609	0.91
22_Y	28_S	1.521	0.88
52_E	57_S	1.512	0.88
55_R	59_V	1.503	0.88
10_K	71_E	1.418	0.84
5_P	66_A	1.332	0.80
20_P	24_Q	1.309	0.79
14_F	49_I	1.278	0.78
35_S	70_V	1.276	0.77
44_P	54_R	1.257	0.76
54_R	61_R	1.253	0.76
27_L	33_P	1.233	0.75
40_V	57_S	1.226	0.75
44_P	61_R	1.223	0.74
9_W	37_F	1.218	0.74
37_F	51_I	1.216	0.74
22_Y	68_L	1.207	0.73
23_R	41_R	1.190	0.72
34_G	53_T	1.175	0.71
4_T	71_E	1.175	0.71
43_A	47_D	1.160	0.70
22_Y	37_F	1.129	0.68
27_L	46_G	1.129	0.68
28_S	68_L	1.116	0.67
42_V	49_I	1.080	0.65
21_A	33_P	1.037	0.61
60_L	69_E	1.012	0.60
26_L	64_D	0.998	0.58
35_S	39_V	0.982	0.57
12_T	66_A	0.964	0.56
44_P	48_P	0.927	0.53
9_W	64_D	0.925	0.53
10_K	17_E	0.916	0.52
13_G	22_Y	0.910	0.51
45_L	61_R	0.908	0.51
45_L	48_P	0.901	0.51
41_R	57_S	0.900	0.51
25_K	28_S	0.886	0.50
36_S	66_A	0.877	0.49
15_S	63_K	0.877	0.49
4_T	37_F	0.876	0.49
43_A	48_P	0.875	0.49
25_K	45_L	0.864	0.48
5_P	40_V	0.863	0.48
47_D	64_D	0.849	0.47
46_G	64_D	0.831	0.45
46_G	61_R	0.822	0.44
14_F	25_K	0.817	0.44
38_N	52_E	0.817	0.44
31_M	59_V	0.815	0.44
48_P	64_D	0.795	0.42
25_K	59_V	0.789	0.42
24_Q	32_L	0.772	0.41
47_D	54_R	0.747	0.39
9_W	59_V	0.743	0.38
5_P	42_V	0.739	0.38
29_L	65_L	0.739	0.38
25_K	31_M	0.735	0.38
22_Y	66_A	0.728	0.37
8_A	66_A	0.710	0.36
14_F	28_S	0.708	0.36
16_R	37_F	0.700	0.35
20_P	40_V	0.692	0.35
45_L	64_D	0.690	0.34
9_W	26_L	0.675	0.33
16_R	69_E	0.667	0.33
13_G	68_L	0.664	0.33
11_I	29_L	0.631	0.30
9_W	70_V	0.625	0.30
12_T	71_E	0.624	0.30
13_G	69_E	0.613	0.29
7_T	10_K	0.602	0.28
38_N	57_S	0.601	0.28
10_K	34_G	0.573	0.26
17_E	39_V	0.570	0.26
32_L	59_V	0.569	0.26
5_P	33_P	0.568	0.26
9_W	39_V	0.563	0.26
7_T	49_I	0.559	0.26
12_T	17_E	0.556	0.25
14_F	67_L	0.555	0.25
11_I	67_L	0.554	0.25
49_I	69_E	0.518	0.23
4_T	63_K	0.516	0.23
17_E	60_L	0.515	0.23
25_K	56_V	0.502	0.22
46_G	54_R	0.500	0.22
59_V	64_D	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2lx9A	1	1	99.5	0.371	Contact Map
2k4yA	1	0.9733	99.5	0.377	Contact Map
2k5iA	1	0.9733	99.5	0.382	Contact Map
2k5fA	1	0.9733	99.5	0.383	Contact Map
2gcxA	1	1	99.4	0.391	Contact Map
2k5lA	1	0.9733	99.4	0.394	Contact Map
3hrsA	2	0.9467	99.4	0.395	Contact Map
2h3jA	1	0.9867	99.4	0.408	Contact Map
3mhxA	1	0.9733	99.4	0.415	Contact Map
3e19A	5	0.9333	99.3	0.423	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.