NUDJ - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NUDJ - Phosphatase NudJ

UniProt:	P0AEI6	Sequences: MFKPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISAQPQHFIRMHQWIAPDKTPFLRFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQASNLRSPLVAESIRCYQSGQRYPLEMIGDFNWPFTKGVI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13446
Length:	153 (123)
Sequences:	4496 (3312)
Seq/√Len:	298.6

ECOLI - NUDJ MUTT NUDG NUDC
BACSU - YVCI MUTT YJHB
HALSA - Q9HR46 Q9HS29
SULSO - Q97WE7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
53_W	59_S	4.660	1.00
22_E	103_C	3.713	1.00
13_H	17_K	3.357	1.00
38_L	47_A	3.233	1.00
63_Q	87_E	2.615	1.00
43_T	46_E	2.572	1.00
61_Q	87_E	2.559	1.00
17_K	108_S	2.389	1.00
108_S	111_E	2.356	1.00
10_C	48_A	2.328	1.00
52_L	60_A	2.309	1.00
60_A	86_I	2.189	1.00
20_V	107_V	2.045	1.00
65_F	82_F	2.043	1.00
14_A	17_K	2.014	1.00
22_E	102_D	1.967	1.00
58_I	88_L	1.875	1.00
69_H	129_C	1.835	1.00
65_F	68_M	1.748	1.00
70_Q	78_P	1.708	1.00
6_V	38_L	1.686	1.00
10_C	52_L	1.683	1.00
49_A	61_Q	1.615	1.00
21_V	101_I	1.575	1.00
49_A	62_P	1.488	1.00
19_L	106_W	1.486	1.00
12_V	52_L	1.442	1.00
10_C	86_I	1.424	1.00
24_T	102_D	1.421	1.00
62_P	86_I	1.405	1.00
49_A	53_W	1.381	1.00
16_G	109_A	1.379	1.00
97_H	100_D	1.351	1.00
124_A	128_R	1.343	1.00
44_L	84_F	1.332	1.00
37_H	79_F	1.277	1.00
64_H	85_A	1.260	1.00
9_A	83_L	1.257	1.00
68_M	82_F	1.256	1.00
119_R	122_L	1.255	1.00
61_Q	89_E	1.253	1.00
44_L	82_F	1.237	1.00
107_V	113_L	1.233	1.00
29_A	102_D	1.227	1.00
31_W	105_R	1.217	1.00
98_D	101_I	1.187	1.00
63_Q	85_A	1.176	1.00
46_E	49_A	1.116	1.00
66_I	85_A	1.109	1.00
88_L	91_I	1.106	1.00
48_A	52_L	1.105	1.00
31_W	107_V	1.104	1.00
120_S	123_V	1.103	1.00
7_T	37_H	1.069	1.00
125_E	128_R	1.050	1.00
113_L	128_R	1.028	1.00
38_L	44_L	1.024	1.00
111_E	114_Q	0.980	1.00
23_E	101_I	0.974	1.00
34_P	56_T	0.972	1.00
109_A	128_R	0.956	1.00
120_S	124_A	0.955	1.00
109_A	113_L	0.953	1.00
125_E	129_C	0.941	1.00
48_A	86_I	0.940	1.00
49_A	60_A	0.938	1.00
105_R	111_E	0.932	1.00
23_E	32_N	0.924	1.00
59_S	89_E	0.919	1.00
22_E	29_A	0.911	1.00
48_A	62_P	0.893	1.00
96_P	99_S	0.877	1.00
44_L	70_Q	0.874	1.00
16_G	108_S	0.871	1.00
23_E	26_N	0.867	1.00
52_L	86_I	0.863	1.00
123_V	126_S	0.846	1.00
126_S	130_Y	0.839	1.00
42_E	50_R	0.836	1.00
21_V	104_C	0.833	1.00
49_A	59_S	0.833	1.00
13_H	16_G	0.830	1.00
13_H	85_A	0.827	1.00
32_N	35_A	0.824	1.00
21_V	34_P	0.812	1.00
38_L	80_L	0.805	1.00
59_S	90_Q	0.791	0.99
22_E	31_W	0.772	0.99
72_I	78_P	0.772	0.99
89_E	92_C	0.768	0.99
91_I	94_T	0.768	0.99
116_S	119_R	0.767	0.99
22_E	105_R	0.761	0.99
62_P	65_F	0.756	0.99
14_A	88_L	0.754	0.99
94_T	97_H	0.747	0.99
6_V	82_F	0.743	0.99
118_L	122_L	0.740	0.99
18_F	130_Y	0.737	0.99
85_A	130_Y	0.733	0.99
51_E	54_E	0.732	0.99
49_A	52_L	0.729	0.99
48_A	84_F	0.726	0.99
10_C	60_A	0.720	0.99
116_S	120_S	0.711	0.99
63_Q	86_I	0.707	0.99
13_H	109_A	0.699	0.99
6_V	80_L	0.699	0.99
31_W	103_C	0.695	0.99
95_Q	98_D	0.694	0.99
20_V	31_W	0.692	0.99
71_W	74_P	0.689	0.99
108_S	113_L	0.686	0.99
22_E	30_L	0.685	0.99
119_R	123_V	0.685	0.99
7_T	79_F	0.676	0.98
17_K	111_E	0.674	0.98
14_A	87_E	0.669	0.98
108_S	112_I	0.668	0.98
97_H	101_I	0.667	0.98
58_I	91_I	0.667	0.98
24_T	29_A	0.663	0.98
51_E	55_E	0.660	0.98
42_E	47_A	0.659	0.98
122_L	126_S	0.652	0.98
65_F	84_F	0.648	0.98
9_A	81_R	0.647	0.98
69_H	83_L	0.638	0.98
18_F	108_S	0.635	0.98
33_Q	83_L	0.622	0.97
127_I	130_Y	0.617	0.97
21_V	32_N	0.615	0.97
33_Q	81_R	0.614	0.97
20_V	105_R	0.612	0.97
122_L	125_E	0.611	0.97
18_F	109_A	0.608	0.97
10_C	13_H	0.605	0.97
24_T	28_K	0.600	0.97
32_N	79_F	0.599	0.97
118_L	121_P	0.598	0.97
68_M	80_L	0.594	0.96
35_A	79_F	0.594	0.96
57_G	96_P	0.586	0.96
11_V	18_F	0.586	0.96
120_S	126_S	0.585	0.96
39_E	46_E	0.579	0.96
45_V	49_A	0.578	0.96
11_V	66_I	0.576	0.96
66_I	70_Q	0.572	0.96
94_T	104_C	0.568	0.95
62_P	88_L	0.566	0.95
53_W	56_T	0.562	0.95
62_P	84_F	0.561	0.95
121_P	124_A	0.559	0.95
116_S	124_A	0.556	0.95
9_A	33_Q	0.555	0.95
70_Q	80_L	0.552	0.95
123_V	127_I	0.552	0.95
8_V	47_A	0.550	0.94
118_L	123_V	0.549	0.94
67_R	70_Q	0.549	0.94
116_S	121_P	0.539	0.94
35_A	81_R	0.539	0.94
21_V	97_H	0.537	0.94
92_C	110_E	0.531	0.93
40_A	78_P	0.528	0.93
32_N	101_I	0.528	0.93
97_H	104_C	0.527	0.93
92_C	95_Q	0.525	0.93
79_F	83_L	0.525	0.93
31_W	102_D	0.524	0.93
32_N	123_V	0.524	0.93
94_T	100_D	0.522	0.93
126_S	129_C	0.519	0.93
73_A	77_T	0.518	0.93
34_P	43_T	0.517	0.93
88_L	106_W	0.515	0.92
113_L	124_A	0.514	0.92
66_I	69_H	0.514	0.92
9_A	120_S	0.514	0.92
124_A	127_I	0.513	0.92
107_V	117_N	0.512	0.92
92_C	129_C	0.503	0.91
52_L	56_T	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4nfwA	6	1	100	0.286	Contact Map
2b0vA	2	0.9477	99.9	0.351	Contact Map
2azwA	1	0.8301	99.9	0.404	Contact Map
3cngA	4	0.9216	99.9	0.406	Contact Map
2qjtB	2	0.8824	99.9	0.407	Contact Map
2qjoA	3	0.8758	99.9	0.41	Contact Map
4dywA	2	0.817	99.9	0.41	Contact Map
3q93A	1	0.9542	99.9	0.414	Contact Map
1vk6A	2	0.8693	99.9	0.418	Contact Map
1ryaA	2	0.8889	99.9	0.423	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.