ELAA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ELAA - Protein ElaA

UniProt:	P0AEH3	Sequences: MIEWQDLHHSELSVSQLYALLQLRCAVFVVEQNCPYQDIDGDDLTGDNRHILGWKNDELVAYARILKSDDDLEPVVIGRVIVSEALRGEKVGQQLMSKTLETCTHHWPDKPVYLGAQAHLQNFYQSFGFIPVTEVYEEDGIPHIGMAREVIQA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13184
Length:	153 (132)
Sequences:	3274 (2476)
Seq/√Len:	215.5

ECOLI - ELAA YIID
BACSU - YJCF YYBD YYAT YITI
HALSA - Q9HPZ8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
100_L	129_F	2.929	1.00
63_A	99_T	2.921	1.00
121_Q	131_P	2.602	1.00
115_G	136_Y	2.516	1.00
25_C	38_D	2.160	1.00
98_K	101_E	2.067	1.00
118_A	135_V	2.062	1.00
135_V	142_P	1.974	1.00
23_L	81_I	1.934	1.00
93_Q	127_F	1.917	1.00
23_L	83_S	1.824	1.00
19_A	54_W	1.800	1.00
100_L	148_R	1.791	1.00
66_L	78_G	1.778	1.00
60_V	86_L	1.745	1.00
13_S	16_Q	1.734	1.00
121_Q	144_I	1.704	1.00
52_L	59_L	1.701	1.00
96_M	127_F	1.692	1.00
53_G	91_V	1.685	1.00
132_V	145_G	1.681	1.00
26_A	83_S	1.652	1.00
77_I	96_M	1.615	1.00
54_W	59_L	1.614	1.00
111_P	147_A	1.598	1.00
17_L	21_L	1.584	1.00
62_Y	81_I	1.546	1.00
53_G	61_A	1.541	1.00
26_A	30_V	1.537	1.00
61_A	82_V	1.533	1.00
132_V	147_A	1.530	1.00
136_Y	145_G	1.519	1.00
125_Q	131_P	1.508	1.00
100_L	112_V	1.471	1.00
93_Q	126_S	1.462	1.00
121_Q	125_Q	1.444	1.00
137_E	140_G	1.427	1.00
51_I	102_T	1.392	1.00
137_E	142_P	1.389	1.00
34_C	141_I	1.359	1.00
133_T	145_G	1.359	1.00
115_G	145_G	1.358	1.00
122_N	125_Q	1.354	1.00
34_C	139_D	1.353	1.00
93_Q	97_S	1.353	1.00
74_P	113_Y	1.304	1.00
22_Q	26_A	1.293	1.00
58_E	85_A	1.284	1.00
68_S	76_V	1.283	1.00
20_L	52_L	1.263	1.00
63_A	80_V	1.262	1.00
49_R	102_T	1.255	1.00
115_G	138_E	1.237	1.00
51_I	99_T	1.236	1.00
80_V	96_M	1.231	1.00
113_Y	145_G	1.211	1.00
32_Q	117_Q	1.202	1.00
25_C	36_Y	1.193	1.00
102_T	105_H	1.170	1.00
26_A	37_Q	1.164	1.00
94_Q	98_K	1.155	1.00
131_P	144_I	1.146	1.00
25_C	29_V	1.142	1.00
21_L	39_I	1.134	1.00
55_K	86_L	1.099	1.00
104_T	148_R	1.065	1.00
15_S	19_A	1.029	1.00
111_P	149_E	1.014	1.00
113_Y	147_A	1.000	1.00
20_L	62_Y	0.990	1.00
55_K	60_V	0.985	1.00
117_Q	143_H	0.981	1.00
86_L	89_E	0.965	1.00
29_V	36_Y	0.957	1.00
118_A	121_Q	0.955	1.00
44_L	48_N	0.952	1.00
25_C	30_V	0.949	1.00
41_G	44_L	0.938	0.99
31_E	87_R	0.937	0.99
25_C	39_I	0.937	0.99
97_S	101_E	0.937	0.99
103_C	112_V	0.931	0.99
77_I	80_V	0.924	0.99
65_I	103_C	0.922	0.99
18_Y	21_L	0.915	0.99
51_I	63_A	0.893	0.99
74_P	111_P	0.887	0.99
76_V	113_Y	0.885	0.99
98_K	102_T	0.883	0.99
19_A	22_Q	0.881	0.99
101_E	105_H	0.880	0.99
120_L	123_F	0.872	0.99
42_D	66_L	0.870	0.99
76_V	114_L	0.869	0.99
49_R	107_W	0.859	0.99
42_D	45_T	0.855	0.99
61_A	95_L	0.854	0.99
116_A	146_M	0.853	0.99
102_T	107_W	0.853	0.99
77_I	99_T	0.837	0.99
63_A	95_L	0.835	0.99
75_V	109_D	0.829	0.99
12_L	20_L	0.820	0.99
67_K	109_D	0.819	0.99
94_Q	97_S	0.818	0.99
30_V	35_P	0.816	0.99
48_N	66_L	0.811	0.99
15_S	44_L	0.805	0.98
14_V	18_Y	0.800	0.98
60_V	91_V	0.796	0.98
65_I	102_T	0.795	0.98
130_I	149_E	0.785	0.98
92_G	123_F	0.784	0.98
55_K	89_E	0.780	0.98
23_L	59_L	0.774	0.98
45_T	48_N	0.764	0.98
66_L	76_V	0.761	0.98
58_E	83_S	0.760	0.98
83_S	86_L	0.758	0.98
16_Q	52_L	0.748	0.98
26_A	85_A	0.744	0.97
118_A	142_P	0.743	0.97
129_F	148_R	0.732	0.97
97_S	127_F	0.726	0.97
31_E	84_E	0.725	0.97
54_W	57_D	0.724	0.97
90_K	93_Q	0.721	0.97
21_L	25_C	0.711	0.97
61_A	91_V	0.708	0.97
112_V	129_F	0.705	0.96
22_Q	41_G	0.699	0.96
45_T	49_R	0.697	0.96
53_G	94_Q	0.694	0.96
14_V	17_L	0.686	0.96
25_C	35_P	0.679	0.96
91_V	94_Q	0.677	0.96
34_C	138_E	0.675	0.95
55_K	58_E	0.673	0.95
76_V	115_G	0.662	0.95
51_I	98_K	0.661	0.95
77_I	112_V	0.658	0.95
114_L	124_Y	0.657	0.95
50_H	62_Y	0.656	0.95
100_L	127_F	0.655	0.95
89_E	92_G	0.654	0.95
75_V	103_C	0.653	0.95
77_I	129_F	0.650	0.94
138_E	141_I	0.649	0.94
29_V	38_D	0.648	0.94
48_N	67_K	0.645	0.94
28_F	117_Q	0.644	0.94
67_K	70_D	0.643	0.94
118_A	144_I	0.641	0.94
131_P	135_V	0.638	0.94
28_F	31_E	0.633	0.94
51_I	65_I	0.632	0.94
121_Q	135_V	0.613	0.93
101_E	104_T	0.608	0.92
43_D	78_G	0.607	0.92
23_L	62_Y	0.605	0.92
125_Q	130_I	0.602	0.92
134_E	144_I	0.602	0.92
78_G	117_Q	0.600	0.92
114_L	146_M	0.598	0.92
53_G	60_V	0.597	0.92
28_F	32_Q	0.595	0.91
77_I	114_L	0.594	0.91
32_Q	143_H	0.593	0.91
95_L	98_K	0.592	0.91
12_L	62_Y	0.590	0.91
66_L	75_V	0.574	0.90
40_D	64_R	0.570	0.90
61_A	92_G	0.567	0.89
67_K	75_V	0.563	0.89
35_P	38_D	0.563	0.89
78_G	143_H	0.561	0.89
29_V	35_P	0.561	0.89
35_P	139_D	0.560	0.89
103_C	109_D	0.555	0.88
82_V	91_V	0.554	0.88
18_Y	41_G	0.545	0.87
18_Y	39_I	0.539	0.87
75_V	107_W	0.538	0.87
88_G	93_Q	0.537	0.87
25_C	37_Q	0.535	0.87
143_H	146_M	0.535	0.87
86_L	91_V	0.531	0.86
28_F	64_R	0.530	0.86
69_D	74_P	0.530	0.86
135_V	144_I	0.529	0.86
92_G	120_L	0.521	0.85
65_I	75_V	0.517	0.85
31_E	117_Q	0.516	0.85
51_I	95_L	0.511	0.84
119_H	141_I	0.502	0.83
31_E	139_D	0.502	0.83
26_A	84_E	0.501	0.83
31_E	79_R	0.500	0.83

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xebA	2	0.9739	100	0.431	Contact Map
1kzfA	1	0.8954	100	0.436	Contact Map
3p2hA	1	0.9281	100	0.44	Contact Map
1ro5A	5	0.9804	99.9	0.446	Contact Map
2g0bA	4	0.9804	99.9	0.466	Contact Map
1q2yA	1	0.902	99.9	0.497	Contact Map
3efaA	2	0.9281	99.9	0.501	Contact Map
2jdcA	1	0.915	99.9	0.506	Contact Map
1y9wA	2	0.902	99.8	0.6	Contact Map
1yvkA	3	0.8954	99.7	0.614	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.