DSBC - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DSBC - Thiol:disulfide interchange protein DsbC

UniProt:	P0AEG6	Sequences: MKKGFMLFTLLAAFSGFAQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11070
Length:	236 (217)
Sequences:	1558 (1230)
Seq/√Len:	83.5

ECOLI - DSBC DSBG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
167_K	171_D	3.936	1.00
143_F	194_G	3.823	1.00
164_D	167_K	3.060	1.00
109_V	139_R	3.060	1.00
117_T	155_E	3.053	1.00
106_E	137_T	2.998	1.00
161_C	183_C	2.966	1.00
127_Q	219_P	2.906	1.00
117_T	152_A	2.795	1.00
153_E	157_K	2.761	1.00
70_P	79_P	2.756	1.00
49_T	84_N	2.443	1.00
73_D	76_G	2.435	1.00
79_P	82_V	2.271	1.00
127_Q	216_Y	2.253	1.00
109_V	137_T	2.229	1.00
193_L	197_L	2.211	1.00
103_A	106_E	2.201	1.00
97_E	190_H	2.187	1.00
151_D	155_E	2.100	1.00
117_T	146_Q	2.098	1.00
146_Q	152_A	2.091	1.00
159_I	172_V	2.051	1.00
132_N	135_G	2.042	1.00
206_V	212_L	2.031	1.00
145_R	152_A	2.015	1.00
102_K	106_E	1.961	1.00
152_A	156_M	1.960	1.00
26_Q	30_A	1.955	1.00
101_Y	170_D	1.938	1.00
221_E	224_E	1.938	1.00
103_A	137_T	1.925	1.00
123_K	127_Q	1.893	1.00
64_K	73_D	1.850	1.00
97_E	189_D	1.798	1.00
98_M	141_L	1.745	1.00
102_K	137_T	1.699	1.00
192_A	196_Q	1.686	1.00
44_V	47_M	1.642	1.00
110_I	205_V	1.637	1.00
100_V	139_R	1.634	1.00
67_I	71_M	1.625	1.00
27_Q	31_K	1.567	1.00
21_D	24_A	1.542	1.00
197_L	206_V	1.540	1.00
124_L	205_V	1.518	0.99
146_Q	150_S	1.476	0.99
199_V	206_V	1.450	0.99
98_M	139_R	1.444	0.99
13_A	16_G	1.436	0.99
52_T	55_G	1.435	0.99
111_T	141_L	1.430	0.99
116_I	159_I	1.409	0.99
116_I	155_E	1.408	0.99
11_L	18_A	1.402	0.99
101_Y	140_Y	1.384	0.99
164_D	168_A	1.378	0.99
189_D	192_A	1.359	0.99
117_T	145_R	1.357	0.99
207_L	213_V	1.294	0.98
48_K	61_D	1.280	0.98
127_Q	130_D	1.280	0.98
111_T	139_R	1.274	0.98
160_W	186_D	1.269	0.98
142_A	156_M	1.262	0.98
14_F	19_Q	1.250	0.98
13_A	20_A	1.236	0.98
124_L	222_M	1.217	0.98
110_I	131_Y	1.195	0.97
13_A	17_F	1.187	0.97
204_A	212_L	1.175	0.97
15_S	19_Q	1.174	0.97
157_K	185_V	1.174	0.97
131_Y	136_I	1.173	0.97
50_V	59_I	1.173	0.97
13_A	18_A	1.171	0.97
14_F	18_A	1.165	0.97
134_L	223_K	1.164	0.97
128_M	138_V	1.139	0.96
37_S	53_N	1.135	0.96
169_F	173_M	1.135	0.96
127_Q	218_P	1.132	0.96
100_V	103_A	1.126	0.96
12_A	17_F	1.126	0.96
218_P	221_E	1.121	0.96
93_A	196_Q	1.111	0.96
130_D	133_A	1.110	0.96
108_H	223_K	1.107	0.96
113_F	193_L	1.087	0.95
187_I	190_H	1.082	0.95
99_I	169_F	1.081	0.95
16_G	20_A	1.079	0.95
129_A	132_N	1.068	0.95
171_D	175_G	1.056	0.94
16_G	23_A	1.054	0.94
134_L	220_K	1.046	0.94
153_E	188_A	1.046	0.94
144_P	194_G	1.044	0.94
157_K	187_I	1.038	0.94
10_L	13_A	1.032	0.94
130_D	134_L	1.031	0.94
42_A	47_M	1.027	0.94
129_A	133_A	1.026	0.93
44_V	71_M	1.016	0.93
36_S	39_I	1.015	0.93
70_P	85_K	1.012	0.93
159_I	186_D	1.002	0.93
12_A	16_G	0.989	0.92
177_S	180_P	0.989	0.92
81_N	84_N	0.985	0.92
185_V	189_D	0.982	0.92
152_A	155_E	0.981	0.92
217_Q	221_E	0.975	0.92
68_Q	72_Y	0.971	0.91
78_A	83_T	0.956	0.91
60_T	63_G	0.956	0.91
192_A	195_V	0.951	0.91
107_K	135_G	0.950	0.91
14_F	17_F	0.949	0.91
112_V	125_H	0.946	0.90
112_V	205_V	0.944	0.90
199_V	204_A	0.941	0.90
142_A	190_H	0.937	0.90
176_K	179_A	0.934	0.90
12_A	15_S	0.934	0.90
142_A	160_W	0.931	0.90
128_M	131_Y	0.917	0.89
119_G	152_A	0.912	0.89
9_T	16_G	0.909	0.89
11_L	14_F	0.905	0.88
8_F	13_A	0.905	0.88
204_A	218_P	0.905	0.88
100_V	137_T	0.903	0.88
64_K	75_S	0.900	0.88
81_N	87_L	0.899	0.88
201_G	204_A	0.895	0.88
12_A	20_A	0.894	0.88
213_V	217_Q	0.892	0.88
47_M	71_M	0.884	0.87
16_G	19_Q	0.882	0.87
8_F	12_A	0.881	0.87
211_T	225_F	0.881	0.87
125_H	140_Y	0.878	0.87
11_L	16_G	0.877	0.87
188_A	192_A	0.864	0.86
213_V	225_F	0.862	0.86
183_C	186_D	0.850	0.85
117_T	122_H	0.848	0.85
82_V	85_K	0.842	0.84
123_K	216_Y	0.841	0.84
161_C	177_S	0.839	0.84
22_D	25_I	0.834	0.84
25_I	59_I	0.834	0.84
58_Y	81_N	0.833	0.84
221_E	225_F	0.832	0.84
119_G	145_R	0.830	0.84
144_P	199_V	0.823	0.83
217_Q	225_F	0.822	0.83
50_V	66_I	0.822	0.83
121_C	203_P	0.821	0.83
42_A	45_A	0.817	0.83
110_I	138_V	0.810	0.82
114_T	125_H	0.808	0.82
22_D	26_Q	0.808	0.82
90_Q	93_A	0.805	0.82
57_L	68_Q	0.803	0.81
106_E	139_R	0.802	0.81
79_P	87_L	0.797	0.81
99_I	159_I	0.793	0.81
108_H	208_S	0.785	0.80
116_I	156_M	0.783	0.80
18_A	21_D	0.779	0.79
12_A	19_Q	0.775	0.79
220_K	224_E	0.775	0.79
13_A	19_Q	0.773	0.79
217_Q	222_M	0.767	0.78
37_S	51_L	0.762	0.78
106_E	156_M	0.760	0.78
163_K	181_A	0.758	0.78
99_I	140_Y	0.748	0.77
14_F	20_A	0.746	0.77
112_V	124_L	0.745	0.76
71_M	82_V	0.743	0.76
208_S	211_T	0.742	0.76
98_M	111_T	0.742	0.76
91_L	111_T	0.739	0.76
73_D	77_T	0.738	0.76
171_D	176_K	0.737	0.76
119_G	122_H	0.736	0.76
79_P	84_N	0.736	0.76
205_V	222_M	0.733	0.75
35_K	38_D	0.727	0.75
131_Y	219_P	0.727	0.75
164_D	200_S	0.726	0.75
23_A	28_T	0.725	0.74
160_W	165_K	0.724	0.74
127_Q	131_Y	0.723	0.74
118_C	203_P	0.718	0.74
187_I	204_A	0.714	0.73
13_A	21_D	0.708	0.73
47_M	94_L	0.704	0.72
43_P	73_D	0.703	0.72
116_I	142_A	0.695	0.71
8_F	11_L	0.694	0.71
8_F	15_S	0.694	0.71
130_D	219_P	0.693	0.71
49_T	56_V	0.692	0.71
118_C	121_C	0.685	0.70
135_G	139_R	0.683	0.70
114_T	119_G	0.678	0.69
24_A	28_T	0.673	0.69
99_I	160_W	0.672	0.69
47_M	67_I	0.672	0.69
182_S	186_D	0.662	0.68
123_K	201_G	0.661	0.67
168_A	171_D	0.660	0.67
60_T	65_H	0.660	0.67
162_A	168_A	0.660	0.67
205_V	226_L	0.659	0.67
110_I	226_L	0.657	0.67
166_N	170_D	0.653	0.67
110_I	128_M	0.651	0.66
8_F	23_A	0.649	0.66
17_F	24_A	0.646	0.66
90_Q	94_L	0.645	0.66
158_A	162_A	0.644	0.65
191_Y	195_V	0.642	0.65
30_A	33_G	0.641	0.65
109_V	112_V	0.640	0.65
14_F	220_K	0.640	0.65
25_I	28_T	0.637	0.65
57_L	62_D	0.636	0.65
120_Y	123_K	0.634	0.64
8_F	27_Q	0.632	0.64
153_E	187_I	0.627	0.63
10_L	75_S	0.627	0.63
106_E	109_V	0.620	0.63
199_V	212_L	0.619	0.62
60_T	64_K	0.615	0.62
141_L	190_H	0.612	0.62
125_H	172_V	0.612	0.62
27_Q	45_A	0.610	0.61
110_I	188_A	0.609	0.61
187_I	191_Y	0.607	0.61
143_F	191_Y	0.604	0.61
170_D	174_A	0.603	0.60
100_V	104_P	0.603	0.60
51_L	56_V	0.602	0.60
194_G	213_V	0.601	0.60
10_L	16_G	0.601	0.60
154_K	157_K	0.595	0.59
104_P	163_K	0.595	0.59
101_Y	138_V	0.593	0.59
72_Y	165_K	0.593	0.59
82_V	86_M	0.592	0.59
28_T	31_K	0.592	0.59
9_T	13_A	0.586	0.58
46_G	69_G	0.586	0.58
119_G	150_S	0.586	0.58
43_P	46_G	0.582	0.58
101_Y	114_T	0.581	0.58
95_E	139_R	0.580	0.57
145_R	150_S	0.579	0.57
72_Y	93_A	0.576	0.57
171_D	200_S	0.575	0.57
140_Y	190_H	0.573	0.57
86_M	176_K	0.570	0.56
150_S	214_P	0.567	0.56
19_Q	22_D	0.566	0.56
79_P	86_M	0.563	0.55
25_I	63_G	0.561	0.55
122_H	175_G	0.560	0.55
111_T	137_T	0.560	0.55
14_F	224_E	0.558	0.55
114_T	173_M	0.557	0.54
19_Q	24_A	0.555	0.54
165_K	169_F	0.552	0.54
9_T	12_A	0.552	0.54
68_Q	224_E	0.551	0.54
17_F	21_D	0.550	0.54
105_Q	137_T	0.550	0.54
124_L	183_C	0.549	0.53
119_G	202_T	0.548	0.53
182_S	185_V	0.548	0.53
140_Y	144_P	0.545	0.53
23_A	26_Q	0.544	0.53
73_D	108_H	0.541	0.52
106_E	111_T	0.540	0.52
78_A	86_M	0.539	0.52
116_I	139_R	0.538	0.52
83_T	196_Q	0.535	0.52
156_M	159_I	0.534	0.51
159_I	168_A	0.534	0.51
11_L	15_S	0.533	0.51
117_T	150_S	0.532	0.51
9_T	30_A	0.530	0.51
16_G	21_D	0.530	0.51
113_F	183_C	0.530	0.51
194_G	204_A	0.528	0.51
171_D	178_V	0.527	0.50
39_I	50_V	0.527	0.50
11_L	19_Q	0.527	0.50
135_G	169_F	0.526	0.50
8_F	28_T	0.526	0.50
43_P	71_M	0.522	0.50
17_F	93_A	0.522	0.50
20_A	23_A	0.520	0.50
99_I	135_G	0.520	0.50
25_I	50_V	0.516	0.49
108_H	111_T	0.512	0.49
97_E	100_V	0.511	0.48
119_G	147_G	0.511	0.48
59_I	63_G	0.510	0.48
118_C	202_T	0.509	0.48
143_F	146_Q	0.508	0.48
51_L	54_S	0.505	0.48
15_S	18_A	0.505	0.48
29_L	63_G	0.505	0.48
101_Y	125_H	0.504	0.47
8_F	14_F	0.503	0.47
105_Q	135_G	0.502	0.47
64_K	74_V	0.501	0.47
27_Q	30_A	0.501	0.47
114_T	169_F	0.501	0.47
162_A	165_K	0.501	0.47
41_P	45_A	0.500	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1t3bA	2	0.8771	100	0.311	Contact Map
4npbA	2	0.9025	100	0.32	Contact Map
1v58A	2	0.8686	100	0.333	Contact Map
1eejA	2	0.9068	100	0.344	Contact Map
4ml1A	4	0.8178	100	0.365	Contact Map
3tdgA	2	0.7712	100	0.377	Contact Map
4pwoA	1	0.8602	100	0.414	Contact Map
3f4sA	1	0.6229	99.9	0.575	Contact Map
4n30A	1	0.6059	99.9	0.577	Contact Map
3ghaA	1	0.6144	99.9	0.582	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0084 seconds.