MAZF - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MAZF - mRNA interferase MazF

UniProt:	P0AE70	Sequences: MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11249
Length:	111 (103)
Sequences:	1499 (983)
Seq/√Len:	96.9

ECOLI - MAZF CHPB
BACSU - ENDOA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_V	102_I	3.360	1.00
61_E	76_D	3.255	1.00
17_F	31_A	3.052	1.00
95_A	98_E	2.999	1.00
69_R	92_G	2.568	1.00
53_T	70_D	2.355	1.00
49_V	75_A	2.337	1.00
49_V	73_A	2.288	1.00
14_W	91_K	2.220	1.00
11_D	93_T	2.204	1.00
9_M	103_K	2.168	1.00
73_A	102_I	2.132	1.00
20_T	26_A	1.964	1.00
10_G	99_L	1.807	1.00
34_L	49_V	1.805	1.00
15_V	31_A	1.734	1.00
101_L	105_K	1.714	1.00
98_E	101_L	1.680	1.00
32_V	94_V	1.660	1.00
8_D	37_F	1.547	1.00
48_C	81_I	1.458	1.00
18_D	26_A	1.451	1.00
15_V	81_I	1.448	1.00
25_Q	29_R	1.424	1.00
21_K	85_A	1.416	1.00
25_Q	74_L	1.407	0.99
16_D	28_H	1.378	0.99
11_D	90_K	1.265	0.99
55_S	72_V	1.256	0.99
64_L	67_Q	1.254	0.99
82_A	85_A	1.221	0.99
39_Y	45_M	1.213	0.98
17_F	79_K	1.209	0.98
73_A	98_E	1.192	0.98
90_K	93_T	1.190	0.98
103_K	110_I	1.183	0.98
36_P	109_L	1.178	0.98
28_H	89_T	1.173	0.98
14_W	89_T	1.161	0.98
68_E	92_G	1.158	0.98
35_S	39_Y	1.153	0.98
34_L	106_I	1.146	0.98
13_I	87_G	1.123	0.97
66_G	92_G	1.116	0.97
39_Y	109_L	1.082	0.97
20_T	79_K	1.075	0.97
14_W	28_H	1.067	0.97
31_A	81_I	1.063	0.96
57_G	61_E	1.044	0.96
58_Y	61_E	1.043	0.96
94_V	99_L	1.029	0.96
14_W	30_P	1.012	0.95
18_D	28_H	0.973	0.94
17_F	48_C	0.963	0.94
45_M	80_S	0.963	0.94
16_D	87_G	0.944	0.93
62_V	98_E	0.924	0.93
12_L	51_C	0.918	0.92
24_E	86_R	0.916	0.92
67_Q	92_G	0.908	0.92
61_E	72_V	0.898	0.91
47_L	80_S	0.889	0.91
96_P	101_L	0.889	0.91
37_F	40_N	0.880	0.91
23_S	44_G	0.875	0.90
13_I	33_V	0.855	0.89
65_S	93_T	0.855	0.89
33_V	48_C	0.852	0.89
106_I	110_I	0.840	0.88
107_N	110_I	0.833	0.88
13_I	88_A	0.827	0.88
17_F	20_T	0.824	0.87
63_V	72_V	0.823	0.87
18_D	27_G	0.821	0.87
47_L	109_L	0.810	0.87
56_K	63_V	0.805	0.86
31_A	48_C	0.795	0.86
19_P	86_R	0.791	0.85
67_Q	71_G	0.784	0.85
58_Y	76_D	0.782	0.85
14_W	88_A	0.782	0.85
96_P	100_Q	0.782	0.85
35_S	109_L	0.772	0.84
36_P	61_E	0.768	0.84
10_G	60_F	0.761	0.83
18_D	89_T	0.751	0.82
78_V	106_I	0.749	0.82
100_Q	104_A	0.743	0.81
40_N	106_I	0.741	0.81
53_T	69_R	0.741	0.81
25_Q	61_E	0.741	0.81
94_V	98_E	0.740	0.81
67_Q	95_A	0.736	0.81
21_K	37_F	0.727	0.80
61_E	74_L	0.727	0.80
39_Y	76_D	0.719	0.79
100_Q	107_N	0.710	0.78
12_L	69_R	0.707	0.78
39_Y	43_T	0.706	0.78
12_L	64_L	0.703	0.78
51_C	71_G	0.696	0.77
35_S	46_C	0.686	0.76
50_P	53_T	0.675	0.75
75_A	110_I	0.672	0.75
23_S	81_I	0.655	0.73
37_F	41_N	0.652	0.72
51_C	64_L	0.641	0.71
49_V	82_A	0.641	0.71
36_P	76_D	0.639	0.71
59_P	76_D	0.638	0.71
49_V	78_V	0.637	0.71
93_T	96_P	0.631	0.70
12_L	92_G	0.631	0.70
13_I	46_C	0.626	0.69
75_A	106_I	0.624	0.69
56_K	59_P	0.619	0.68
12_L	94_V	0.606	0.67
60_F	76_D	0.604	0.67
9_M	99_L	0.603	0.66
68_E	95_A	0.603	0.66
52_T	77_Q	0.602	0.66
60_F	74_L	0.595	0.65
54_Q	74_L	0.595	0.65
11_D	84_R	0.595	0.65
40_N	99_L	0.588	0.64
55_S	63_V	0.588	0.64
47_L	74_L	0.584	0.64
7_P	90_K	0.583	0.64
39_Y	60_F	0.581	0.64
103_K	107_N	0.581	0.64
54_Q	61_E	0.573	0.62
34_L	110_I	0.573	0.62
57_G	72_V	0.571	0.62
39_Y	47_L	0.561	0.61
51_C	66_G	0.561	0.61
38_M	104_A	0.557	0.60
20_T	74_L	0.553	0.60
60_F	75_A	0.551	0.60
74_L	77_Q	0.551	0.60
27_G	74_L	0.547	0.59
12_L	67_Q	0.544	0.59
10_G	74_L	0.543	0.58
103_K	106_I	0.540	0.58
99_L	102_I	0.539	0.58
15_V	87_G	0.539	0.58
84_R	90_K	0.509	0.54
49_V	102_I	0.508	0.53
46_C	80_S	0.507	0.53
19_P	26_A	0.507	0.53
63_V	89_T	0.507	0.53
50_P	56_K	0.503	0.53
12_L	101_L	0.502	0.53
21_K	41_N	0.501	0.52
16_D	88_A	0.500	0.52

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ub4A	2	0.9279	100	0.26	Contact Map
4mzmA	2	0.955	100	0.271	Contact Map
1m1fA	2	0.9369	100	0.29	Contact Map
4mdxA	2	0.964	100	0.306	Contact Map
2kmtA	2	0.8829	99.2	0.676	Contact Map
3vubA	2	0.8468	98.8	0.719	Contact Map
3pmiA	4	0.7477	28.2	0.921	Contact Map
4eyzA	1	0.6126	13.7	0.932	Contact Map
4muqA	1	0.6577	12.1	0.933	Contact Map
2faoA	1	0.9189	11.8	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.