CHAB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CHAB - Cation transport regulator ChaB

UniProt:	P0AE63	Sequences: MPYKTKSDLPESVKHVLPSHAQDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWAAVKHEYAKGDDDKWHKKS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12402
Length:	76 (69)
Sequences:	178 (113)
Seq/√Len:	13.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_Y	53_H	7.200	1.00
67_G	73_H	4.307	1.00
6_K	23_D	3.636	0.99
6_K	26_K	2.967	0.97
36_Y	55_V	2.391	0.90
47_S	50_E	2.014	0.80
63_E	74_K	1.625	0.64
65_A	73_H	1.610	0.63
50_E	61_K	1.413	0.53
33_W	50_E	1.412	0.52
16_V	73_H	1.391	0.51
17_L	21_A	1.381	0.51
6_K	19_S	1.368	0.50
45_D	50_E	1.367	0.50
46_A	55_V	1.336	0.48
21_A	29_F	1.236	0.43
27_E	35_Q	1.221	0.42
33_W	48_R	1.210	0.42
32_A	36_Y	1.194	0.41
4_K	29_F	1.160	0.39
4_K	75_K	1.149	0.39
16_V	71_K	1.134	0.38
62_H	74_K	1.083	0.35
22_Q	35_Q	1.063	0.34
67_G	70_D	1.057	0.34
65_A	75_K	1.056	0.34
45_D	61_K	1.054	0.34
19_S	23_D	1.044	0.33
9_L	13_V	1.003	0.31
34_D	61_K	1.001	0.31
23_D	26_K	0.993	0.31
29_F	62_H	0.991	0.31
12_S	15_H	0.978	0.30
58_A	75_K	0.955	0.29
46_A	50_E	0.939	0.29
8_D	17_L	0.937	0.28
53_H	66_K	0.928	0.28
7_S	47_S	0.925	0.28
35_Q	38_D	0.922	0.28
58_A	62_H	0.921	0.28
1_M	10_P	0.907	0.27
35_Q	55_V	0.903	0.27
70_D	74_K	0.892	0.27
48_R	51_T	0.883	0.26
37_K	51_T	0.854	0.25
19_S	45_D	0.837	0.24
25_Y	33_W	0.837	0.24
12_S	73_H	0.829	0.24
4_K	11_E	0.817	0.24
7_S	50_E	0.812	0.23
46_A	54_K	0.800	0.23
7_S	29_F	0.794	0.23
23_D	33_W	0.786	0.22
2_P	10_P	0.785	0.22
22_Q	59_A	0.770	0.22
27_E	63_E	0.756	0.21
19_S	71_K	0.754	0.21
49_E	61_K	0.754	0.21
26_K	44_D	0.741	0.21
31_S	71_K	0.739	0.21
3_Y	10_P	0.737	0.21
5_T	70_D	0.732	0.20
11_E	14_K	0.725	0.20
3_Y	27_E	0.715	0.20
26_K	54_K	0.708	0.20
44_D	63_E	0.666	0.18
37_K	71_K	0.666	0.18
4_K	68_D	0.664	0.18
64_Y	72_W	0.664	0.18
22_Q	72_W	0.638	0.17
31_S	66_K	0.638	0.17
27_E	31_S	0.635	0.17
34_D	55_V	0.621	0.17
8_D	71_K	0.621	0.17
14_K	54_K	0.618	0.17
36_Y	46_A	0.616	0.17
23_D	31_S	0.613	0.17
20_H	66_K	0.611	0.17
34_D	48_R	0.604	0.16
54_K	62_H	0.600	0.16
23_D	63_E	0.595	0.16
21_A	31_S	0.592	0.16
33_W	53_H	0.581	0.16
45_D	65_A	0.574	0.15
2_P	59_A	0.571	0.15
12_S	67_G	0.566	0.15
11_E	70_D	0.553	0.15
23_D	51_T	0.553	0.15
38_D	55_V	0.551	0.15
13_V	22_Q	0.548	0.15
14_K	75_K	0.547	0.15
51_T	54_K	0.545	0.15
38_D	62_H	0.542	0.15
16_V	26_K	0.536	0.14
16_V	67_G	0.535	0.14
20_H	23_D	0.535	0.14
22_Q	58_A	0.533	0.14
25_Y	48_R	0.532	0.14
7_S	12_S	0.531	0.14
58_A	63_E	0.525	0.14
5_T	37_K	0.521	0.14
16_V	23_D	0.515	0.14
46_A	52_A	0.505	0.14
4_K	19_S	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1sg7A	1	0.9868	100	0.166	Contact Map
1zy7A	1	0.7632	12.1	0.929	Contact Map
3aa0A	1	0.9737	10.5	0.931	Contact Map
2xocA	1	0.3947	8.5	0.934	Contact Map
1fc6A	1	0.6053	6.2	0.938	Contact Map
4ayoA	1	0.6053	5.5	0.94	Contact Map
1wx0A	6	0.25	4.4	0.942	Contact Map
1uvqC	1	0.2632	4.3	0.942	Contact Map
1dl2A	1	0.5789	4.2	0.943	Contact Map
4ld6A	1	0.6579	4	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.