BCP - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BCP - Putative peroxiredoxin bcp

UniProt:	P0AE52	Sequences: MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSRFAEKELLNFTLLSDEDHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFDDFKTSNHHDVVLNWLKEHA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10108
Length:	156 (142)
Sequences:	11607 (7152)
Seq/√Len:	600.2

ECOLI - BCP AHPC TPX DSBE
BACSU - YKUU BCP AHPC TPX YKUV RESA STOA YNEN
HALSA - Q9HQE6 Q9HP28 Q9HN00 Q9HRG4
SULSO - Q97VL0 Q97WG5 Q97WP9 TDXH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_R	128_A	3.260	1.00
14_S	22_Q	2.906	1.00
31_Q	66_D	2.792	1.00
41_A	78_L	2.693	1.00
54_R	88_N	2.680	1.00
10_A	103_F	2.516	1.00
14_S	24_N	2.479	1.00
127_D	133_E	2.426	1.00
57_M	61_K	2.371	1.00
16_P	22_Q	2.301	1.00
17_D	21_E	2.194	1.00
9_I	131_K	2.176	1.00
107_G	120_H	2.109	1.00
56_N	59_E	2.024	1.00
12_K	26_T	1.998	1.00
5_K	8_D	1.931	1.00
18_Q	82_A	1.876	1.00
24_N	27_D	1.867	1.00
127_D	131_K	1.847	1.00
57_M	88_N	1.793	1.00
12_K	24_N	1.776	1.00
72_T	97_H	1.750	1.00
15_L	92_L	1.678	1.00
134_H	151_W	1.666	1.00
98_Q	102_Q	1.641	1.00
72_T	100_C	1.638	1.00
23_V	28_F	1.625	1.00
50_A	87_L	1.613	1.00
15_L	99_V	1.598	1.00
56_N	145_H	1.496	1.00
42_M	85_E	1.494	1.00
17_D	23_V	1.481	1.00
61_K	66_D	1.434	1.00
42_M	80_R	1.381	1.00
79_S	83_E	1.358	1.00
65_V	152_L	1.332	1.00
17_D	90_T	1.332	1.00
34_L	125_L	1.312	1.00
54_R	89_F	1.307	1.00
28_F	68_L	1.302	1.00
100_C	119_I	1.297	1.00
28_F	33_V	1.284	1.00
33_V	66_D	1.278	1.00
126_I	132_I	1.270	1.00
58_D	61_K	1.240	1.00
97_H	101_E	1.230	1.00
72_T	119_I	1.208	1.00
146_D	150_N	1.202	1.00
32_R	65_V	1.185	1.00
33_V	68_L	1.185	1.00
16_P	75_P	1.174	1.00
56_N	146_D	1.163	1.00
6_A	134_H	1.162	1.00
37_F	70_I	1.161	1.00
99_V	103_F	1.155	1.00
51_C	55_D	1.144	1.00
136_F	151_W	1.140	1.00
59_E	62_K	1.139	1.00
69_G	91_L	1.139	1.00
32_R	133_E	1.139	1.00
147_V	150_N	1.105	1.00
52_G	56_N	1.095	1.00
10_A	126_I	1.087	1.00
36_Y	50_A	1.085	1.00
48_V	142_S	1.075	1.00
105_V	122_I	1.066	1.00
76_E	80_R	1.064	1.00
42_M	84_K	1.053	1.00
51_C	54_R	1.039	1.00
105_V	124_F	0.996	1.00
97_H	106_W	0.993	1.00
59_E	149_L	0.992	1.00
58_D	62_K	0.992	1.00
53_L	67_V	0.986	1.00
33_V	130_G	0.972	1.00
34_L	123_S	0.968	1.00
80_R	83_E	0.968	1.00
42_M	77_K	0.959	1.00
13_F	103_F	0.958	1.00
30_G	128_A	0.953	1.00
10_A	132_I	0.943	1.00
25_L	33_V	0.941	1.00
36_Y	89_F	0.930	1.00
52_G	55_D	0.924	1.00
12_K	25_L	0.920	1.00
143_N	146_D	0.919	1.00
101_E	106_W	0.914	1.00
79_S	82_A	0.913	1.00
19_D	79_S	0.906	1.00
125_L	134_H	0.904	1.00
125_L	151_W	0.904	1.00
66_D	90_T	0.902	1.00
13_F	99_V	0.890	1.00
75_P	93_S	0.888	1.00
17_D	92_L	0.887	1.00
23_V	68_L	0.876	1.00
74_K	77_K	0.874	1.00
97_H	100_C	0.873	1.00
68_L	92_L	0.868	1.00
35_V	126_I	0.862	1.00
17_D	20_G	0.860	1.00
98_Q	101_E	0.859	1.00
47_T	85_E	0.845	1.00
124_F	132_I	0.837	1.00
34_L	65_V	0.828	1.00
33_V	126_I	0.826	1.00
29_Q	130_G	0.826	1.00
63_A	152_L	0.816	1.00
100_C	106_W	0.815	1.00
6_A	132_I	0.808	1.00
108_E	111_F	0.805	1.00
140_K	143_N	0.796	1.00
81_F	85_E	0.790	1.00
32_R	64_G	0.788	1.00
64_G	128_A	0.787	1.00
48_V	51_C	0.787	1.00
6_A	135_V	0.784	1.00
70_I	99_V	0.783	1.00
133_E	138_D	0.778	1.00
107_G	110_S	0.776	1.00
143_N	147_V	0.771	1.00
51_C	85_E	0.769	1.00
10_A	25_L	0.768	1.00
49_Q	123_S	0.767	1.00
125_L	136_F	0.765	1.00
54_R	57_M	0.761	1.00
134_H	147_V	0.758	1.00
35_V	103_F	0.755	1.00
16_P	95_E	0.755	1.00
26_T	29_Q	0.752	1.00
5_K	135_V	0.749	1.00
109_K	118_G	0.747	1.00
19_D	82_A	0.744	1.00
18_Q	90_T	0.743	1.00
136_F	148_V	0.742	1.00
60_L	149_L	0.737	1.00
120_H	138_D	0.729	1.00
25_L	28_F	0.724	1.00
58_D	88_N	0.719	1.00
122_I	135_V	0.712	1.00
76_E	79_S	0.696	1.00
40_K	73_D	0.696	1.00
37_F	105_V	0.692	1.00
53_L	148_V	0.687	1.00
34_L	53_L	0.681	1.00
43_T	121_R	0.680	1.00
120_H	137_D	0.671	1.00
78_L	81_F	0.667	1.00
40_K	118_G	0.664	1.00
110_S	118_G	0.660	1.00
59_E	63_A	0.658	1.00
39_P	43_T	0.651	1.00
75_P	79_S	0.650	1.00
49_Q	53_L	0.649	1.00
32_R	125_L	0.649	1.00
38_Y	41_A	0.648	1.00
63_A	149_L	0.643	1.00
18_Q	79_S	0.640	1.00
82_A	91_L	0.638	1.00
50_A	69_G	0.636	1.00
123_S	148_V	0.635	1.00
11_P	102_Q	0.635	1.00
52_G	145_H	0.635	1.00
28_F	66_D	0.632	1.00
36_Y	49_Q	0.632	1.00
41_A	77_K	0.629	1.00
74_K	95_E	0.628	1.00
10_A	99_V	0.624	1.00
54_R	58_D	0.623	1.00
9_I	29_Q	0.620	1.00
99_V	102_Q	0.618	1.00
8_D	135_V	0.614	1.00
38_Y	69_G	0.596	1.00
37_F	103_F	0.594	1.00
34_L	148_V	0.594	1.00
73_D	77_K	0.593	1.00
56_N	60_L	0.591	1.00
44_P	47_T	0.588	1.00
57_M	66_D	0.584	1.00
40_K	43_T	0.583	1.00
124_F	135_V	0.577	1.00
137_D	141_T	0.572	1.00
32_R	152_L	0.570	1.00
107_G	118_G	0.567	1.00
138_D	142_S	0.565	1.00
94_D	97_H	0.559	1.00
53_L	145_H	0.556	0.99
77_K	80_R	0.556	0.99
68_L	90_T	0.554	0.99
126_I	130_G	0.552	0.99
60_L	65_V	0.546	0.99
57_M	67_V	0.544	0.99
125_L	148_V	0.535	0.99
78_L	93_S	0.531	0.99
36_Y	69_G	0.531	0.99
100_C	105_V	0.530	0.99
34_L	152_L	0.529	0.99
23_V	27_D	0.522	0.99
29_Q	129_D	0.521	0.99
36_Y	53_L	0.519	0.99
105_V	120_H	0.518	0.99
31_Q	64_G	0.517	0.99
13_F	25_L	0.512	0.99
20_G	75_P	0.511	0.99
107_G	111_F	0.509	0.99
38_Y	81_F	0.509	0.99
16_P	20_G	0.508	0.99
35_V	68_L	0.507	0.99
12_K	29_Q	0.506	0.99
36_Y	123_S	0.504	0.99
67_V	89_F	0.501	0.99
40_K	74_K	0.500	0.99
39_P	121_R	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1prxA	2	0.9936	100	0.258	Contact Map
2v2gA	2	0.9808	100	0.265	Contact Map
1xccA	2	0.9808	100	0.273	Contact Map
3a2vA	5	0.9615	100	0.29	Contact Map
1xiyA	1	0.9615	100	0.294	Contact Map
3w6gA	6	0.9359	100	0.295	Contact Map
2xhfA	2	0.9295	100	0.314	Contact Map
3ixrA	1	0.9872	100	0.318	Contact Map
1xvwA	3	0.9615	100	0.32	Contact Map
3tjjA	3	0.9615	100	0.328	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.