YIEE - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YIEE - Uncharacterized protein YieE

UniProt:	P0ADM8	Sequences: MATHFARGILTEGHLISVRLPSQCHQEARNIPPHRQSRFLASRGLLAELMFMLYGIGELPEIVTLPKGKPVFSDKNLPSFSISYAGNMVGVALTTEGECGLDMELQRATRGFHSPHAPDNHTFSSNESLWISKQNDPNEARAQLITLRRSVLKLTGDVLNDDPRDLQLLPIAGRLKCAHVNHVEALCDAEDVLVWSVAVTPTIEKLSVWELDGKHGWKSLPDIHSRANNPTSRMMRFAQLSTVKAFSPN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11722
Length:	249 (193)
Sequences:	1190 (1015)
Seq/√Len:	73.1

ECOLI - YIEE ACPT
BACSU - SFP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
79_S	98_E	4.130	1.00
124_S	167_Q	3.464	1.00
69_K	79_S	3.264	1.00
147_L	168_L	3.224	1.00
92_A	99_C	3.197	1.00
90_G	101_L	3.019	1.00
90_G	195_W	2.889	1.00
24_C	43_R	2.785	1.00
39_F	43_R	2.552	1.00
181_N	188_D	2.423	1.00
152_L	163_P	2.286	1.00
63_V	71_V	2.238	1.00
152_L	157_D	2.073	1.00
49_L	93_L	2.066	1.00
60_P	72_F	2.042	1.00
92_A	197_V	2.036	1.00
150_S	198_A	2.021	1.00
181_N	185_A	2.020	1.00
50_M	80_F	2.000	1.00
85_A	104_E	1.976	1.00
181_N	187_C	1.968	1.00
35_R	38_R	1.942	1.00
28_A	39_F	1.940	1.00
24_C	39_F	1.911	1.00
123_F	166_L	1.908	1.00
31_I	35_R	1.877	1.00
126_N	167_Q	1.857	1.00
119_D	128_S	1.806	1.00
69_K	98_E	1.756	1.00
154_L	181_N	1.749	1.00
51_F	60_P	1.723	1.00
140_A	144_L	1.697	1.00
45_L	89_V	1.692	1.00
104_E	146_T	1.686	1.00
127_E	148_R	1.676	1.00
152_L	159_L	1.646	1.00
134_Q	137_P	1.640	1.00
51_F	58_E	1.623	0.99
28_A	40_L	1.621	0.99
162_D	166_L	1.496	0.99
24_C	47_A	1.489	0.99
54_Y	60_P	1.485	0.99
119_D	122_T	1.466	0.99
147_L	185_A	1.456	0.99
147_L	196_S	1.445	0.99
42_S	89_V	1.430	0.99
146_T	196_S	1.428	0.99
17_S	29_R	1.420	0.99
120_N	128_S	1.409	0.99
49_L	91_V	1.398	0.98
183_V	186_L	1.394	0.98
88_M	190_E	1.389	0.98
145_I	158_V	1.385	0.98
152_L	161_D	1.375	0.98
24_C	51_F	1.359	0.98
118_P	152_L	1.354	0.98
26_Q	30_N	1.342	0.98
92_A	101_L	1.341	0.98
34_H	38_R	1.337	0.98
38_R	87_N	1.334	0.98
190_E	193_L	1.310	0.98
35_R	89_V	1.289	0.97
21_P	47_A	1.278	0.97
82_I	91_V	1.268	0.97
45_L	91_V	1.255	0.97
152_L	166_L	1.233	0.97
122_T	163_P	1.214	0.96
131_I	144_L	1.199	0.96
56_I	60_P	1.197	0.96
20_L	39_F	1.197	0.96
130_W	140_A	1.194	0.96
27_E	39_F	1.185	0.96
83_S	90_G	1.182	0.96
43_R	82_I	1.179	0.96
38_R	86_G	1.176	0.95
144_L	147_L	1.172	0.95
161_D	165_D	1.162	0.95
94_T	99_C	1.149	0.95
138_N	142_A	1.118	0.94
47_A	51_F	1.117	0.94
41_A	89_V	1.111	0.94
130_W	144_L	1.105	0.94
118_P	141_R	1.104	0.94
106_Q	142_A	1.103	0.94
159_L	163_P	1.099	0.93
47_A	58_E	1.080	0.93
185_A	188_D	1.073	0.93
63_V	73_S	1.041	0.92
107_R	142_A	1.036	0.91
86_G	105_L	1.025	0.91
159_L	162_D	1.023	0.91
54_Y	72_F	1.021	0.91
21_P	43_R	1.020	0.91
118_P	123_F	1.016	0.90
103_M	193_L	1.013	0.90
17_S	25_H	1.008	0.90
51_F	54_Y	1.005	0.90
20_L	24_C	0.995	0.90
143_Q	194_V	0.978	0.89
119_D	131_I	0.972	0.88
106_Q	194_V	0.971	0.88
103_M	133_K	0.966	0.88
61_E	73_S	0.964	0.88
46_L	82_I	0.963	0.88
123_F	163_P	0.963	0.88
35_R	86_G	0.962	0.88
28_A	31_I	0.959	0.88
32_P	35_R	0.949	0.87
104_E	119_D	0.934	0.86
145_I	149_R	0.934	0.86
47_A	60_P	0.932	0.86
120_N	132_S	0.919	0.85
53_L	78_P	0.914	0.85
69_K	80_F	0.911	0.85
45_L	90_G	0.897	0.84
183_V	188_D	0.897	0.84
43_R	64_T	0.896	0.84
38_R	85_A	0.889	0.84
181_N	186_L	0.883	0.83
113_H	137_P	0.883	0.83
46_L	89_V	0.882	0.83
122_T	166_L	0.876	0.83
102_D	149_R	0.874	0.82
111_G	117_A	0.865	0.82
22_S	25_H	0.856	0.81
30_N	81_S	0.851	0.81
24_C	58_E	0.845	0.80
17_S	28_A	0.845	0.80
98_E	200_T	0.845	0.80
140_A	143_Q	0.844	0.80
28_A	150_S	0.841	0.80
81_S	101_L	0.837	0.80
152_L	162_D	0.837	0.80
16_I	40_L	0.826	0.79
27_E	64_T	0.823	0.79
151_V	155_T	0.821	0.78
147_L	183_V	0.820	0.78
129_L	133_K	0.816	0.78
141_R	145_I	0.816	0.78
143_Q	185_A	0.812	0.78
78_P	87_N	0.810	0.77
124_S	177_C	0.807	0.77
22_S	26_Q	0.796	0.76
50_M	93_L	0.794	0.76
147_L	151_V	0.792	0.76
72_F	196_S	0.791	0.76
43_R	46_L	0.787	0.75
131_I	140_A	0.779	0.75
46_L	80_F	0.777	0.74
24_C	199_V	0.777	0.74
144_L	168_L	0.773	0.74
161_D	166_L	0.773	0.74
20_L	40_L	0.766	0.73
39_F	198_A	0.766	0.73
20_L	36_Q	0.765	0.73
104_E	122_T	0.765	0.73
12_E	16_I	0.762	0.73
147_L	167_Q	0.758	0.73
147_L	150_S	0.748	0.72
34_H	86_G	0.747	0.72
151_V	198_A	0.745	0.71
117_A	121_H	0.745	0.71
26_Q	69_K	0.744	0.71
186_L	195_W	0.724	0.69
127_E	159_L	0.713	0.68
43_R	47_A	0.712	0.68
79_S	94_T	0.711	0.68
84_Y	141_R	0.707	0.67
50_M	60_P	0.707	0.67
151_V	168_L	0.705	0.67
150_S	195_W	0.703	0.67
53_L	181_N	0.702	0.67
177_C	180_V	0.701	0.67
156_G	159_L	0.700	0.67
142_A	194_V	0.699	0.66
122_T	164_R	0.699	0.66
85_A	146_T	0.697	0.66
16_I	45_L	0.697	0.66
157_D	160_N	0.697	0.66
50_M	170_P	0.695	0.66
99_C	106_Q	0.694	0.66
154_L	158_V	0.691	0.66
46_L	91_V	0.688	0.65
20_L	43_R	0.687	0.65
46_L	85_A	0.686	0.65
14_H	17_S	0.686	0.65
28_A	47_A	0.682	0.65
59_L	125_S	0.677	0.64
147_L	195_W	0.675	0.64
80_F	91_V	0.673	0.63
50_M	78_P	0.671	0.63
11_T	164_R	0.670	0.63
65_L	71_V	0.669	0.63
157_D	161_D	0.665	0.63
94_T	199_V	0.665	0.63
100_G	153_K	0.662	0.62
125_S	129_L	0.661	0.62
78_P	136_D	0.658	0.62
184_E	188_D	0.658	0.62
97_G	200_T	0.653	0.61
72_F	101_L	0.650	0.61
17_S	44_G	0.649	0.61
122_T	128_S	0.648	0.61
125_S	164_R	0.643	0.60
16_I	19_R	0.643	0.60
152_L	158_V	0.641	0.60
139_E	194_V	0.640	0.60
83_S	149_R	0.639	0.59
39_F	42_S	0.638	0.59
173_G	176_K	0.637	0.59
39_F	104_E	0.634	0.59
62_I	69_K	0.630	0.58
80_F	141_R	0.628	0.58
79_S	96_E	0.627	0.58
51_F	131_I	0.626	0.58
123_F	141_R	0.626	0.58
81_S	84_Y	0.625	0.58
128_S	132_S	0.617	0.57
48_E	52_M	0.616	0.57
55_G	59_L	0.616	0.57
101_L	195_W	0.614	0.56
85_A	141_R	0.612	0.56
50_M	62_I	0.612	0.56
69_K	81_S	0.605	0.55
88_M	103_M	0.604	0.55
84_Y	102_D	0.604	0.55
85_A	105_L	0.602	0.55
18_V	62_I	0.599	0.55
136_D	139_E	0.598	0.55
65_L	160_N	0.598	0.55
155_T	161_D	0.597	0.54
141_R	149_R	0.594	0.54
25_H	29_R	0.588	0.53
93_L	196_S	0.586	0.53
123_F	151_V	0.582	0.53
62_I	72_F	0.581	0.52
105_L	192_V	0.581	0.52
81_S	142_A	0.577	0.52
67_K	160_N	0.576	0.52
28_A	46_L	0.576	0.52
57_G	73_S	0.576	0.52
65_L	98_E	0.574	0.52
27_E	36_Q	0.574	0.52
51_F	150_S	0.572	0.51
108_A	121_H	0.571	0.51
40_L	45_L	0.567	0.51
151_V	163_P	0.566	0.51
21_P	24_C	0.561	0.50
79_S	97_G	0.560	0.50
178_A	181_N	0.560	0.50
65_L	166_L	0.558	0.50
133_K	179_H	0.556	0.49
167_Q	198_A	0.555	0.49
47_A	50_M	0.553	0.49
130_W	152_L	0.551	0.49
187_C	190_E	0.549	0.48
142_A	163_P	0.549	0.48
43_R	150_S	0.549	0.48
24_C	27_E	0.549	0.48
119_D	123_F	0.547	0.48
107_R	133_K	0.546	0.48
84_Y	149_R	0.544	0.48
49_L	94_T	0.543	0.48
95_T	129_L	0.541	0.47
75_K	196_S	0.538	0.47
176_K	202_T	0.537	0.47
62_I	163_P	0.537	0.47
149_R	158_V	0.535	0.47
88_M	193_L	0.535	0.47
47_A	148_R	0.533	0.46
78_P	165_D	0.531	0.46
183_V	197_V	0.531	0.46
121_H	151_V	0.530	0.46
35_R	159_L	0.529	0.46
51_F	195_W	0.529	0.46
128_S	131_I	0.528	0.46
46_L	104_E	0.528	0.46
39_F	82_I	0.524	0.45
46_L	64_T	0.522	0.45
42_S	46_L	0.520	0.45
148_R	158_V	0.518	0.45
35_R	43_R	0.518	0.45
168_L	183_V	0.518	0.45
31_I	66_P	0.517	0.45
152_L	160_N	0.516	0.44
141_R	163_P	0.509	0.44
60_P	148_R	0.504	0.43
111_G	142_A	0.504	0.43
123_F	128_S	0.503	0.43
54_Y	63_V	0.500	0.42

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1qr0A	2	0.8594	100	0.392	Contact Map
2c43A	1	0.8835	100	0.396	Contact Map
4qvhA	2	0.7671	100	0.532	Contact Map
4qjkA	1	0.7711	100	0.539	Contact Map
4jm7A	3	0.49	99.9	0.664	Contact Map
2wasA	3	0.4096	99.6	0.742	Contact Map
2wdsA	3	0.4257	99.6	0.748	Contact Map
3hykA	3	0.4297	99.6	0.749	Contact Map
3qmnA	4	0.4378	99.6	0.753	Contact Map
1fthA	3	0.4297	99.6	0.753	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.