FIMB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FIMB - Type 1 fimbriae regulatory protein FimB

UniProt:	P0ADH5	Sequences: MKNKADNKKRNFLTHSEIESLLKAANTGPHAARNYCLTLLCFIHGFRASEICRLRISDIDLKAKCIYIHRLKKGFSTTHPLLNKEVQALKNWLSIRTSYPHAESEWVFLSRKGNPLSRQQFYHIISTSGGNAGLSLEIHPHMLRHSCGFALANMGIDTRLIQDYLGHRNIRHTVWYTASNAGRFYGIWDRARGRQRHAVL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10309
Length:	200 (178)
Sequences:	29832 (22782)
Seq/√Len:	1707.6

ECOLI - FIMB FIME XERC INTR XERD INTQ INTD INTF INTB INTZ INTA INTS INTE
BACSU - YOEC XERC XERD INT YOMM YOPP
HALSA - Q9HR66 Q9HQV5 O52010 Q9HSI7 O54590
SULSO - Q980D9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
148_G	165_L	4.873	1.00
56_I	93_L	3.014	1.00
77_T	166_G	2.940	1.00
147_C	164_Y	2.711	1.00
139_H	142_M	2.688	1.00
41_C	140_P	2.340	1.00
67_Y	78_T	2.307	1.00
45_G	147_C	2.231	1.00
41_C	51_I	2.192	1.00
64_K	86_V	2.191	1.00
55_R	106_W	2.176	1.00
159_R	162_Q	2.079	1.00
48_A	141_H	2.070	1.00
65_C	78_T	2.023	1.00
43_I	82_L	1.990	1.00
55_R	115_P	1.973	1.00
36_C	92_W	1.905	1.00
145_H	178_A	1.875	1.00
86_V	90_K	1.875	1.00
18_I	42_F	1.857	1.00
39_L	88_A	1.853	1.00
14_T	17_E	1.801	1.00
75_F	168_R	1.730	1.00
151_L	156_I	1.729	1.00
34_N	124_I	1.728	1.00
81_L	86_V	1.697	1.00
157_D	160_L	1.696	1.00
167_H	173_T	1.658	1.00
159_R	163_D	1.655	1.00
165_L	173_T	1.643	1.00
153_N	183_R	1.634	1.00
152_A	161_I	1.632	1.00
15_H	150_A	1.589	1.00
49_S	53_R	1.557	1.00
48_A	52_C	1.540	1.00
48_A	118_R	1.510	1.00
35_Y	39_L	1.472	1.00
13_L	146_S	1.470	1.00
18_I	150_A	1.468	1.00
60_D	63_A	1.464	1.00
25_A	128_S	1.459	1.00
80_P	164_Y	1.448	1.00
26_N	35_Y	1.446	1.00
162_Q	170_I	1.445	1.00
50_E	77_T	1.424	1.00
55_R	58_D	1.423	1.00
46_F	51_I	1.405	1.00
152_A	177_T	1.372	1.00
172_H	175_W	1.345	1.00
129_G	138_I	1.334	1.00
58_D	69_H	1.319	1.00
22_L	39_L	1.309	1.00
42_F	150_A	1.309	1.00
151_L	161_I	1.308	1.00
118_R	122_Y	1.297	1.00
124_I	127_T	1.290	1.00
46_F	68_I	1.288	1.00
37_L	121_F	1.287	1.00
60_D	65_C	1.284	1.00
147_C	151_L	1.279	1.00
61_L	90_K	1.275	1.00
70_R	76_S	1.259	1.00
120_Q	123_H	1.254	1.00
42_F	143_L	1.239	1.00
55_R	105_E	1.237	1.00
13_L	138_I	1.232	1.00
153_N	180_N	1.223	1.00
171_R	174_V	1.222	1.00
106_W	115_P	1.218	1.00
149_F	178_A	1.209	1.00
24_A	131_N	1.208	1.00
158_T	174_V	1.194	1.00
15_H	154_M	1.185	1.00
36_C	88_A	1.185	1.00
43_I	85_E	1.185	1.00
170_I	174_V	1.152	1.00
42_F	146_S	1.137	1.00
160_L	187_I	1.133	1.00
43_I	84_K	1.122	1.00
56_I	107_V	1.120	1.00
37_L	51_I	1.119	1.00
35_Y	88_A	1.107	1.00
57_S	105_E	1.107	1.00
36_C	91_N	1.106	1.00
54_L	66_I	1.090	1.00
17_E	20_S	1.089	1.00
117_S	120_Q	1.087	1.00
70_R	74_G	1.086	1.00
150_A	153_N	1.083	1.00
13_L	21_L	1.079	1.00
20_S	24_A	1.079	1.00
24_A	132_A	1.066	1.00
125_I	129_G	1.064	1.00
12_F	146_S	1.062	1.00
122_Y	126_S	1.061	1.00
37_L	108_F	1.058	1.00
119_Q	122_Y	1.051	1.00
146_S	150_A	1.008	1.00
163_D	184_F	1.005	1.00
64_K	83_N	0.996	1.00
48_A	122_Y	0.992	1.00
32_A	95_I	0.991	1.00
67_Y	76_S	0.978	1.00
56_I	96_R	0.977	1.00
48_A	121_F	0.969	1.00
57_S	104_S	0.966	1.00
92_W	96_R	0.958	1.00
25_A	38_T	0.951	1.00
106_W	109_L	0.933	1.00
110_S	114_N	0.929	1.00
82_L	85_E	0.923	1.00
126_S	137_E	0.918	1.00
61_L	86_V	0.916	1.00
11_N	142_M	0.913	1.00
19_E	23_K	0.912	1.00
159_R	174_V	0.910	1.00
15_H	19_E	0.906	1.00
128_S	131_N	0.906	1.00
186_G	190_R	0.900	1.00
162_Q	173_T	0.898	1.00
122_Y	140_P	0.896	1.00
169_N	172_H	0.890	1.00
183_R	186_G	0.883	1.00
36_C	108_F	0.880	1.00
83_N	87_Q	0.877	1.00
185_Y	189_D	0.872	1.00
80_P	185_Y	0.867	1.00
47_R	141_H	0.861	1.00
125_I	143_L	0.860	1.00
39_L	84_K	0.859	1.00
71_L	77_T	0.856	1.00
127_T	131_N	0.853	1.00
32_A	91_N	0.852	1.00
52_C	121_F	0.850	1.00
40_L	108_F	0.850	1.00
147_C	165_L	0.843	1.00
24_A	128_S	0.842	1.00
120_Q	124_I	0.835	1.00
164_Y	184_F	0.827	1.00
44_H	79_H	0.822	1.00
91_N	95_I	0.816	1.00
96_R	109_L	0.813	1.00
21_L	38_T	0.808	1.00
162_Q	174_V	0.804	1.00
41_C	143_L	0.803	1.00
153_N	182_G	0.803	1.00
158_T	170_I	0.800	1.00
60_D	67_Y	0.795	1.00
13_L	17_E	0.790	1.00
85_E	88_A	0.788	1.00
88_A	91_N	0.779	1.00
40_L	85_E	0.777	1.00
124_I	128_S	0.775	1.00
39_L	43_I	0.765	1.00
81_L	85_E	0.765	1.00
148_G	161_I	0.762	1.00
125_I	140_P	0.762	1.00
40_L	66_I	0.753	1.00
156_I	160_L	0.750	1.00
84_K	87_Q	0.746	1.00
25_A	35_Y	0.738	1.00
48_A	140_P	0.727	1.00
12_F	178_A	0.716	1.00
126_S	130_G	0.712	1.00
181_A	184_F	0.706	1.00
121_F	140_P	0.703	1.00
38_T	143_L	0.698	1.00
52_C	118_R	0.694	1.00
180_N	183_R	0.693	1.00
36_C	85_E	0.684	1.00
18_I	22_L	0.683	1.00
148_G	177_T	0.680	1.00
15_H	153_N	0.680	1.00
12_F	149_F	0.678	1.00
67_Y	70_R	0.678	1.00
40_L	46_F	0.676	1.00
187_I	190_R	0.676	1.00
156_I	187_I	0.673	1.00
13_L	18_I	0.673	1.00
123_H	127_T	0.671	1.00
138_I	142_M	0.669	1.00
65_C	185_Y	0.658	1.00
16_S	20_S	0.656	1.00
92_W	95_I	0.650	1.00
32_A	36_C	0.648	1.00
33_R	92_W	0.641	1.00
38_T	125_I	0.639	1.00
39_L	85_E	0.628	1.00
40_L	51_I	0.628	1.00
53_R	115_P	0.628	1.00
36_C	40_L	0.627	1.00
34_N	128_S	0.621	1.00
33_R	116_L	0.621	1.00
59_I	107_V	0.620	1.00
93_L	96_R	0.620	1.00
182_G	186_G	0.619	1.00
126_S	129_G	0.616	1.00
24_A	27_T	0.616	1.00
27_T	31_A	0.614	1.00
117_S	123_H	0.607	1.00
46_F	66_I	0.606	1.00
149_F	177_T	0.606	1.00
148_G	173_T	0.603	1.00
40_L	89_L	0.595	1.00
33_R	124_I	0.593	1.00
36_C	89_L	0.589	1.00
148_G	167_H	0.588	1.00
44_H	82_L	0.588	1.00
60_D	64_K	0.587	1.00
45_G	165_L	0.585	1.00
33_R	36_C	0.581	1.00
56_I	97_T	0.581	1.00
142_M	145_H	0.580	1.00
152_A	157_D	0.579	1.00
30_H	111_R	0.579	1.00
156_I	190_R	0.578	1.00
61_L	64_K	0.576	1.00
157_D	187_I	0.576	1.00
152_A	180_N	0.575	1.00
50_E	71_L	0.570	1.00
93_L	97_T	0.569	1.00
161_I	177_T	0.568	1.00
119_Q	126_S	0.568	1.00
20_S	23_K	0.566	1.00
21_L	129_G	0.566	1.00
152_A	179_S	0.566	1.00
49_S	71_L	0.561	1.00
46_F	50_E	0.557	1.00
125_I	138_I	0.555	1.00
32_A	35_Y	0.554	1.00
89_L	107_V	0.549	1.00
87_Q	91_N	0.544	1.00
90_K	94_S	0.544	1.00
13_L	142_M	0.542	1.00
22_L	35_Y	0.537	1.00
41_C	48_A	0.537	1.00
145_H	175_W	0.536	1.00
159_R	170_I	0.536	1.00
159_R	177_T	0.535	1.00
61_L	81_L	0.534	1.00
58_D	70_R	0.532	1.00
9_K	76_S	0.527	1.00
50_E	166_G	0.526	1.00
168_R	172_H	0.526	1.00
53_R	70_R	0.525	1.00
160_L	183_R	0.525	1.00
151_L	164_Y	0.525	1.00
160_L	164_Y	0.523	1.00
93_L	107_V	0.522	1.00
61_L	107_V	0.520	1.00
156_I	161_I	0.518	1.00
119_Q	123_H	0.518	1.00
55_R	104_S	0.518	1.00
83_N	189_D	0.517	1.00
20_S	134_L	0.517	1.00
20_S	132_A	0.515	1.00
184_F	188_W	0.511	1.00
22_L	25_A	0.511	1.00
120_Q	127_T	0.508	1.00
186_G	189_D	0.508	1.00
7_N	175_W	0.506	1.00
59_I	66_I	0.505	1.00
152_A	158_T	0.504	1.00
90_K	93_L	0.503	1.00
162_Q	172_H	0.502	1.00
10_R	145_H	0.501	1.00
91_N	94_S	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3nkhA	2	0.955	100	0.218	Contact Map
2a3vA	3	0.945	100	0.22	Contact Map
1a0pA	1	0.88	100	0.254	Contact Map
4a8eA	2	0.895	100	0.263	Contact Map
1z1bA	3	0.915	100	0.273	Contact Map
1z19A	3	0.925	100	0.279	Contact Map
1xo0A	3	0.955	100	0.284	Contact Map
1ae9A	4	0.825	100	0.301	Contact Map
1aihA	2	0.84	100	0.352	Contact Map
3vcfA	1	0.785	99.9	0.444	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.