DBHB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DBHB - DNA-binding protein HU-beta

UniProt:	P0ACF4	Sequences: MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10467
Length:	90 (89)
Sequences:	4703 (2618)
Seq/√Len:	277.5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
53_K	78_S	3.359	1.00
59_T	68_E	2.754	1.00
35_S	40_D	2.563	1.00
22_G	26_D	2.560	1.00
54_E	75_K	2.448	1.00
57_A	70_T	2.369	1.00
61_R	66_G	2.318	1.00
59_T	70_T	2.165	1.00
52_V	75_K	2.132	1.00
8_D	18_K	2.085	1.00
60_G	71_I	2.064	1.00
20_A	23_R	2.003	1.00
83_K	87_D	1.989	1.00
10_I	25_L	1.886	1.00
19_A	23_R	1.830	1.00
61_R	68_E	1.822	1.00
54_E	73_A	1.646	1.00
51_A	80_R	1.625	1.00
28_I	32_V	1.603	1.00
36_L	85_L	1.587	1.00
36_L	52_V	1.515	1.00
41_D	49_T	1.484	1.00
41_D	51_A	1.433	1.00
55_R	76_V	1.428	1.00
33_T	85_L	1.400	1.00
10_I	28_I	1.375	1.00
17_S	20_A	1.372	1.00
21_A	24_A	1.351	1.00
45_V	82_G	1.331	1.00
9_K	13_G	1.329	1.00
6_L	44_L	1.273	1.00
16_I	24_A	1.167	1.00
9_K	31_S	1.154	1.00
16_I	21_A	1.143	1.00
13_G	34_E	1.137	1.00
3_K	26_D	1.130	1.00
57_A	73_A	1.116	1.00
32_V	42_V	1.085	1.00
30_A	33_T	1.049	1.00
33_T	88_A	1.047	1.00
9_K	12_A	1.046	1.00
13_G	31_S	1.039	1.00
34_E	38_E	1.027	1.00
48_G	79_F	1.025	1.00
37_K	88_A	1.019	1.00
14_A	21_A	0.996	1.00
43_A	49_T	0.980	1.00
29_I	47_F	0.953	1.00
39_G	75_K	0.951	1.00
64_Q	67_K	0.951	1.00
29_I	44_L	0.948	1.00
31_S	35_S	0.943	1.00
8_D	12_A	0.912	1.00
27_A	31_S	0.911	1.00
47_F	50_F	0.906	1.00
25_L	29_I	0.896	1.00
74_A	86_K	0.893	1.00
16_I	20_A	0.881	1.00
5_Q	8_D	0.856	1.00
51_A	78_S	0.854	1.00
28_I	31_S	0.846	1.00
58_R	76_V	0.838	1.00
1_M	5_Q	0.834	1.00
62_N	67_K	0.812	0.99
77_P	89_V	0.808	0.99
47_F	82_G	0.808	0.99
36_L	77_P	0.778	0.99
84_A	87_D	0.771	0.99
34_E	37_K	0.769	0.99
13_G	30_A	0.768	0.99
61_R	64_Q	0.760	0.99
55_R	74_A	0.752	0.99
2_N	5_Q	0.742	0.99
49_T	80_R	0.729	0.99
62_N	66_G	0.719	0.99
60_G	69_I	0.710	0.99
43_A	58_R	0.709	0.98
77_P	86_K	0.704	0.98
35_S	42_V	0.698	0.98
77_P	85_L	0.697	0.98
30_A	34_E	0.695	0.98
10_I	24_A	0.694	0.98
31_S	34_E	0.692	0.98
15_D	23_R	0.686	0.98
24_A	31_S	0.680	0.98
13_G	27_A	0.679	0.98
4_S	8_D	0.676	0.98
55_R	58_R	0.676	0.98
10_I	14_A	0.670	0.98
33_T	37_K	0.667	0.98
45_V	84_A	0.664	0.98
22_G	41_D	0.655	0.97
35_S	38_E	0.654	0.97
50_F	79_F	0.630	0.97
11_A	14_A	0.629	0.97
38_E	54_E	0.622	0.97
39_G	54_E	0.619	0.96
34_E	54_E	0.618	0.96
23_R	27_A	0.618	0.96
60_G	68_E	0.614	0.96
57_A	72_A	0.608	0.96
29_I	33_T	0.607	0.96
26_D	30_A	0.604	0.96
7_I	22_G	0.601	0.96
53_K	76_V	0.590	0.95
17_S	21_A	0.587	0.95
49_T	82_G	0.580	0.95
43_A	84_A	0.575	0.95
32_V	47_F	0.571	0.94
19_A	22_G	0.565	0.94
59_T	69_I	0.562	0.94
62_N	65_T	0.553	0.94
15_D	21_A	0.549	0.93
3_K	22_G	0.544	0.93
27_A	30_A	0.542	0.93
18_K	49_T	0.540	0.93
2_N	6_L	0.536	0.92
9_K	38_E	0.536	0.92
2_N	45_V	0.535	0.92
46_G	82_G	0.534	0.92
9_K	35_S	0.530	0.92
56_A	75_K	0.529	0.92
10_I	21_A	0.523	0.92
14_A	24_A	0.522	0.91
11_A	18_K	0.521	0.91
52_V	85_L	0.516	0.91
21_A	31_S	0.508	0.90
14_A	27_A	0.508	0.90
32_V	50_F	0.506	0.90
15_D	20_A	0.505	0.90
4_S	58_R	0.505	0.90
61_R	69_I	0.502	0.90
41_D	84_A	0.502	0.90
38_E	70_T	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qjuA	2	1	100	0.146	Contact Map
4p3vA	2	0.8	100	0.154	Contact Map
2iieA	1	1	100	0.156	Contact Map
1mulA	2	0.8444	100	0.158	Contact Map
1b8zA	2	0.7444	100	0.159	Contact Map
1exeA	2	1	100	0.164	Contact Map
1p71A	2	1	100	0.164	Contact Map
4pt4A	2	1	100	0.166	Contact Map
1owfB	1	1	100	0.166	Contact Map
1owfA	1	1	100	0.17	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.