HINT - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HINT - HIT-like protein HinT

UniProt:	P0ACE7	Sequences: MAEETIFSKIIRREIPSDIVYQDDLVTAFRDISPQAPTHILIIPNILIPTVNDVSAEHEQALGRMITVAAKIAEQEGIAEDGYRLIMNTNRHGGQEVYHIHMHLLGGRPLGPMLAHKGL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12172
Length:	119 (107)
Sequences:	5262 (3306)
Seq/√Len:	319.6

ECOLI - HINT
BACSU - HIT
HALSA - Q9HNA0 Q9HP05
SULSO - YHIT Q980P0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_D	30_R	3.017	1.00
5_T	8_S	2.980	1.00
22_Q	45_N	2.718	1.00
8_S	47_L	2.456	1.00
25_L	64_R	2.431	1.00
13_R	19_I	2.419	1.00
81_D	92_H	2.357	1.00
5_T	47_L	2.269	1.00
46_I	58_H	2.266	1.00
29_F	43_I	2.199	1.00
30_R	76_E	2.075	1.00
19_I	27_T	2.067	1.00
20_V	40_I	2.014	1.00
87_M	102_M	1.950	1.00
9_K	14_E	1.923	1.00
23_D	64_R	1.824	1.00
55_S	58_H	1.651	1.00
27_T	45_N	1.635	1.00
17_S	27_T	1.629	1.00
8_S	12_R	1.604	1.00
42_I	104_L	1.532	1.00
19_I	22_Q	1.526	1.00
25_L	61_A	1.520	1.00
26_V	64_R	1.499	1.00
26_V	65_M	1.473	1.00
28_A	40_I	1.463	1.00
50_T	53_D	1.441	1.00
37_P	108_R	1.416	1.00
92_H	109_P	1.400	1.00
52_N	83_Y	1.394	1.00
10_I	17_S	1.388	1.00
59_E	67_T	1.382	1.00
84_R	107_G	1.305	1.00
66_I	102_M	1.295	1.00
78_I	106_G	1.270	1.00
40_I	104_L	1.243	1.00
50_T	90_N	1.224	1.00
70_A	74_E	1.181	1.00
54_V	100_I	1.168	1.00
4_E	8_S	1.164	1.00
65_M	102_M	1.163	1.00
49_P	53_D	1.155	1.00
35_Q	105_L	1.132	1.00
50_T	89_T	1.103	1.00
26_V	68_V	1.094	1.00
48_I	100_I	1.093	1.00
71_K	75_Q	1.079	1.00
38_T	106_G	1.061	1.00
11_I	27_T	1.061	1.00
72_I	76_E	1.058	1.00
91_R	98_Y	1.057	1.00
21_Y	68_V	1.056	1.00
48_I	55_S	1.054	1.00
6_I	32_I	1.046	1.00
50_T	98_Y	1.033	1.00
64_R	68_V	1.031	1.00
30_R	40_I	1.029	1.00
56_A	67_T	1.021	1.00
87_M	100_I	1.010	1.00
68_V	71_K	0.999	1.00
27_T	43_I	0.998	1.00
86_I	105_L	0.993	1.00
49_P	90_N	0.978	1.00
48_I	54_V	0.951	1.00
62_L	66_I	0.947	1.00
20_V	30_R	0.941	1.00
84_R	88_N	0.925	1.00
82_G	93_G	0.919	1.00
9_K	15_I	0.915	1.00
35_Q	96_E	0.880	1.00
4_E	12_R	0.878	1.00
40_I	72_I	0.874	1.00
46_I	55_S	0.874	1.00
71_K	74_E	0.866	1.00
63_G	66_I	0.849	1.00
56_A	70_A	0.837	1.00
48_I	58_H	0.824	1.00
28_A	42_I	0.803	1.00
36_A	108_R	0.798	1.00
82_G	92_H	0.790	1.00
54_V	62_L	0.783	1.00
30_R	38_T	0.783	1.00
67_T	71_K	0.765	0.99
36_A	105_L	0.765	0.99
4_E	9_K	0.748	0.99
46_I	61_A	0.744	0.99
83_Y	104_L	0.744	0.99
51_V	85_L	0.742	0.99
11_I	43_I	0.739	0.99
60_Q	64_R	0.736	0.99
63_G	67_T	0.731	0.99
85_L	89_T	0.725	0.99
68_V	72_I	0.721	0.99
13_R	22_Q	0.720	0.99
49_P	98_Y	0.719	0.99
51_V	66_I	0.716	0.99
40_I	76_E	0.714	0.99
66_I	69_A	0.709	0.99
52_N	89_T	0.708	0.99
61_A	64_R	0.700	0.99
72_I	75_Q	0.699	0.99
4_E	47_L	0.698	0.99
38_T	78_I	0.695	0.99
107_G	110_L	0.690	0.99
6_I	15_I	0.690	0.99
23_D	26_V	0.690	0.99
25_L	60_Q	0.682	0.99
67_T	70_A	0.679	0.99
77_G	80_E	0.665	0.99
83_Y	88_N	0.660	0.98
56_A	60_Q	0.655	0.98
59_E	63_G	0.654	0.98
51_V	87_M	0.653	0.98
86_I	108_R	0.639	0.98
40_I	69_A	0.632	0.98
6_I	9_K	0.632	0.98
93_G	96_E	0.628	0.98
8_S	11_I	0.627	0.98
25_L	46_I	0.623	0.98
90_N	93_G	0.617	0.98
59_E	62_L	0.612	0.98
54_V	59_E	0.611	0.98
6_I	97_V	0.607	0.97
31_D	105_L	0.606	0.97
23_D	61_A	0.605	0.97
47_L	99_H	0.603	0.97
23_D	68_V	0.596	0.97
57_E	60_Q	0.595	0.97
65_M	69_A	0.590	0.97
58_H	61_A	0.585	0.97
78_I	81_D	0.581	0.97
23_D	71_K	0.576	0.96
5_T	99_H	0.574	0.96
91_R	109_P	0.573	0.96
61_A	65_M	0.570	0.96
73_A	104_L	0.569	0.96
26_V	61_A	0.565	0.96
19_I	45_N	0.564	0.96
15_I	32_I	0.558	0.96
83_Y	89_T	0.555	0.96
82_G	106_G	0.551	0.95
11_I	17_S	0.545	0.95
52_N	90_N	0.545	0.95
84_R	93_G	0.537	0.95
8_S	99_H	0.534	0.95
31_D	88_N	0.529	0.94
73_A	76_E	0.528	0.94
80_E	108_R	0.525	0.94
64_R	67_T	0.525	0.94
51_V	67_T	0.524	0.94
3_E	14_E	0.521	0.94
10_I	16_P	0.517	0.94
18_D	32_I	0.515	0.94
86_I	107_G	0.513	0.93
33_S	97_V	0.510	0.93
46_I	57_E	0.509	0.93
95_Q	98_Y	0.508	0.93
15_I	33_S	0.503	0.93
60_Q	63_G	0.502	0.93
65_M	68_V	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ksvA	2	0.9748	100	0.223	Contact Map
3n1sA	6	1	100	0.231	Contact Map
3lb5A	2	0.9832	100	0.249	Contact Map
3o0mA	2	0.958	100	0.267	Contact Map
3l7xA	2	0.9748	100	0.269	Contact Map
3imiA	2	0.9832	100	0.272	Contact Map
2pofA	1	0.9664	100	0.272	Contact Map
4njyA	2	0.8319	100	0.283	Contact Map
1y23A	2	0.9664	100	0.285	Contact Map
2eo4A	2	0.958	100	0.286	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.