WCAF - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

WCAF - Putative colanic acid biosynthesis acetyltransferase WcaF

UniProt:	P0ACD2	Sequences: MQDLSGFSVPKGFRGGNAIKVQLWWAVQATIFAWSPQVLYRWRAFLLRLFGAKIGKNVVIRPSVKITYPWKLTLGDYAWVGDDVNLYTLGEITIGAHSVISQKSYLCTGSHDHASQHFTINATPIVIGEKCWLATDVFVAPGVTIGDGTVVGARSSVFKSLPANVVCRGNPAVVIRERVETE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13574
Length:	182 (158)
Sequences:	5055 (3763)
Seq/√Len:	299.4

ECOLI - WCAF THGA WBBJ MAA WCAB YRDA CAIE CYSE PAAY YAIX
BACSU - MAA YVOF CYSE DAPH EPSM YTOA
HALSA - Q9HQ06 Q9HPT3 Q9HNN1
SULSO - Q980E1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
86_L	92_I	3.384	1.00
106_L	125_I	2.937	1.00
77_Y	97_H	2.887	1.00
128_G	147_D	2.846	1.00
148_G	164_N	2.834	1.00
161_L	167_C	2.728	1.00
73_T	93_T	2.434	1.00
152_G	168_R	2.401	1.00
168_R	175_I	2.291	1.00
147_D	163_A	2.291	1.00
83_D	103_K	2.229	1.00
53_K	73_T	2.186	1.00
55_G	76_D	2.163	1.00
76_D	96_A	2.158	1.00
129_E	147_D	2.059	1.00
140_A	153_A	2.032	1.00
130_K	148_G	2.016	1.00
107_C	135_T	1.847	1.00
93_T	126_V	1.837	1.00
149_T	163_A	1.801	1.00
97_H	130_K	1.759	1.00
96_A	129_E	1.732	1.00
30_T	34_W	1.726	1.00
133_L	139_V	1.724	1.00
165_V	177_E	1.712	1.00
39_L	42_W	1.685	1.00
165_V	174_V	1.652	1.00
74_L	78_A	1.614	1.00
149_T	165_V	1.610	1.00
95_G	129_E	1.602	1.00
128_G	144_T	1.557	1.00
151_V	161_L	1.556	1.00
103_K	136_D	1.548	1.00
167_C	174_V	1.542	1.00
106_L	127_I	1.530	1.00
149_T	161_L	1.522	1.00
113_H	150_V	1.478	1.00
30_T	37_Q	1.469	1.00
78_A	96_A	1.458	1.00
75_G	96_A	1.442	1.00
90_G	122_A	1.436	1.00
126_V	144_T	1.420	1.00
54_I	58_V	1.411	1.00
174_V	177_E	1.396	1.00
57_N	77_Y	1.392	1.00
89_L	122_A	1.387	1.00
25_W	28_Q	1.368	1.00
73_T	91_E	1.358	1.00
144_T	160_S	1.350	1.00
44_A	48_R	1.348	1.00
133_L	137_V	1.343	1.00
162_P	174_V	1.323	1.00
105_Y	136_D	1.298	1.00
100_I	106_L	1.268	1.00
167_C	172_A	1.261	1.00
104_S	137_V	1.252	1.00
155_S	172_A	1.249	1.00
98_S	129_E	1.230	1.00
151_V	167_C	1.227	1.00
80_V	84_V	1.218	1.00
22_Q	25_W	1.214	1.00
78_A	129_E	1.192	1.00
98_S	147_D	1.133	1.00
140_A	158_F	1.130	1.00
162_P	167_C	1.122	1.00
78_A	98_S	1.112	1.00
52_A	73_T	1.095	1.00
85_N	103_K	1.084	1.00
31_I	36_P	1.082	1.00
146_G	163_A	1.078	1.00
94_I	100_I	1.061	1.00
42_W	45_F	1.042	1.00
30_T	36_P	1.039	1.00
123_T	142_G	1.034	1.00
143_V	159_K	1.020	1.00
106_L	139_V	1.016	1.00
110_S	141_P	1.012	1.00
128_G	163_A	1.012	1.00
155_S	170_N	1.010	1.00
137_V	155_S	0.999	1.00
131_C	149_T	0.998	1.00
56_K	76_D	0.990	1.00
105_Y	135_T	0.978	1.00
23_L	70_W	0.970	1.00
113_H	166_V	0.965	1.00
110_S	123_T	0.962	1.00
105_Y	138_F	0.951	1.00
110_S	121_N	0.948	1.00
61_R	79_W	0.947	1.00
111_H	132_W	0.941	1.00
27_V	38_V	0.939	1.00
151_V	157_V	0.938	1.00
48_R	54_I	0.938	1.00
74_L	94_I	0.935	1.00
94_I	106_L	0.923	1.00
143_V	160_S	0.921	1.00
72_L	88_T	0.916	1.00
98_S	131_C	0.913	1.00
156_S	170_N	0.909	1.00
166_V	178_R	0.908	1.00
24_W	28_Q	0.907	1.00
21_V	70_W	0.903	1.00
95_G	128_G	0.900	1.00
127_I	133_L	0.899	1.00
100_I	133_L	0.898	1.00
162_P	165_V	0.894	1.00
147_D	164_N	0.893	1.00
80_V	100_I	0.890	1.00
95_G	126_V	0.878	1.00
80_V	86_L	0.875	1.00
25_W	29_A	0.874	1.00
138_F	154_R	0.872	1.00
21_V	24_W	0.855	1.00
58_V	74_L	0.855	1.00
58_V	78_A	0.855	1.00
66_I	72_L	0.854	1.00
130_K	147_D	0.835	1.00
94_I	127_I	0.830	1.00
21_V	25_W	0.823	1.00
57_N	76_D	0.823	1.00
74_L	80_V	0.821	1.00
24_W	27_V	0.815	1.00
160_S	167_C	0.811	1.00
32_F	35_S	0.810	1.00
93_T	124_P	0.788	0.99
35_S	43_R	0.785	0.99
104_S	133_L	0.785	0.99
94_I	98_S	0.784	0.99
100_I	104_S	0.780	0.99
46_L	50_F	0.776	0.99
84_V	104_S	0.775	0.99
91_E	124_P	0.771	0.99
67_T	89_L	0.769	0.99
22_Q	28_Q	0.762	0.99
131_C	147_D	0.759	0.99
47_L	51_G	0.759	0.99
32_F	47_L	0.758	0.99
102_Q	135_T	0.747	0.99
27_V	30_T	0.745	0.99
154_R	170_N	0.742	0.99
139_V	145_I	0.736	0.99
166_V	176_R	0.733	0.99
45_F	49_L	0.728	0.99
27_V	36_P	0.725	0.99
29_A	33_A	0.719	0.99
69_P	88_T	0.718	0.99
65_K	82_D	0.716	0.99
136_D	154_R	0.703	0.99
31_I	42_W	0.701	0.99
51_G	54_I	0.699	0.99
79_W	99_V	0.698	0.99
78_A	94_I	0.698	0.99
128_G	149_T	0.694	0.99
127_I	131_C	0.690	0.99
55_G	58_V	0.688	0.99
23_L	27_V	0.684	0.99
145_I	151_V	0.680	0.98
145_I	161_L	0.670	0.98
72_L	86_L	0.666	0.98
23_L	26_A	0.664	0.98
91_E	126_V	0.664	0.98
128_G	146_G	0.654	0.98
86_L	106_L	0.650	0.98
89_L	109_G	0.649	0.98
35_S	42_W	0.646	0.98
71_K	91_E	0.641	0.98
30_T	33_A	0.641	0.98
125_I	141_P	0.636	0.98
81_G	132_W	0.635	0.98
28_Q	49_L	0.633	0.98
131_C	163_A	0.632	0.98
146_G	160_S	0.631	0.97
87_Y	109_G	0.629	0.97
150_V	166_V	0.622	0.97
138_F	156_S	0.617	0.97
64_V	72_L	0.617	0.97
165_V	168_R	0.613	0.97
107_C	138_F	0.613	0.97
65_K	83_D	0.611	0.97
161_L	172_A	0.609	0.97
31_I	35_S	0.605	0.97
168_R	173_V	0.605	0.97
110_S	113_H	0.604	0.97
109_G	122_A	0.599	0.97
22_Q	27_V	0.598	0.97
36_P	39_L	0.598	0.97
28_Q	31_I	0.594	0.96
78_A	100_I	0.594	0.96
54_I	76_D	0.588	0.96
127_I	139_V	0.588	0.96
31_I	34_W	0.585	0.96
145_I	149_T	0.580	0.96
168_R	172_A	0.578	0.96
108_T	141_P	0.578	0.96
22_Q	26_A	0.575	0.96
85_N	105_Y	0.572	0.96
100_I	127_I	0.572	0.96
36_P	40_Y	0.565	0.95
148_G	163_A	0.561	0.95
35_S	39_L	0.555	0.95
34_W	37_Q	0.554	0.95
109_G	120_I	0.554	0.95
60_I	64_V	0.553	0.95
98_S	127_I	0.551	0.95
151_V	172_A	0.551	0.95
90_G	108_T	0.551	0.95
21_V	28_Q	0.546	0.94
75_G	98_S	0.545	0.94
101_S	110_S	0.543	0.94
156_S	168_R	0.540	0.94
27_V	31_I	0.540	0.94
165_V	178_R	0.538	0.94
68_Y	120_I	0.535	0.94
60_I	80_V	0.534	0.94
81_G	99_V	0.528	0.93
32_F	62_P	0.528	0.93
77_Y	96_A	0.527	0.93
47_L	54_I	0.527	0.93
29_A	66_I	0.526	0.93
99_V	111_H	0.524	0.93
63_S	83_D	0.523	0.93
157_V	161_L	0.522	0.93
74_L	98_S	0.520	0.93
41_R	45_F	0.519	0.93
58_V	76_D	0.518	0.93
64_V	84_V	0.516	0.92
58_V	96_A	0.514	0.92
161_L	174_V	0.514	0.92
30_T	35_S	0.513	0.92
161_L	165_V	0.512	0.92
162_P	177_E	0.511	0.92
67_T	87_Y	0.508	0.92
81_G	111_H	0.508	0.92
154_R	158_F	0.505	0.92
108_T	122_A	0.503	0.92
92_I	108_T	0.502	0.91
145_I	167_C	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3srtA	3	0.989	100	0.193	Contact Map
3fttA	3	1	100	0.201	Contact Map
1krrA	3	1	100	0.207	Contact Map
3nz2A	4	0.978	100	0.219	Contact Map
2p2oA	3	0.9835	100	0.219	Contact Map
3hjjA	3	0.989	100	0.227	Contact Map
1ocxA	3	0.9725	100	0.252	Contact Map
3vbiA	3	0.7912	100	0.435	Contact Map
4mzuA	5	0.8077	99.9	0.442	Contact Map
1mr7A	3	0.8242	99.9	0.45	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.