ERPA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ERPA - Iron-sulfur cluster insertion protein ErpA

UniProt:	P0ACC3	Sequences: MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12332
Length:	114 (105)
Sequences:	3631 (1899)
Seq/√Len:	185.3

ECOLI - ERPA ISCA SUFA
BACSU - SUFA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
83_S	98_T	4.512	1.00
18_K	21_S	3.579	1.00
32_K	70_V	3.109	1.00
16_A	65_Q	3.067	1.00
72_D	75_S	3.037	1.00
36_Y	48_G	2.865	1.00
10_E	83_S	2.717	1.00
102_A	105_T	2.642	1.00
13_D	65_Q	2.544	1.00
63_E	68_G	2.498	1.00
9_L	84_V	2.348	1.00
61_T	68_G	2.255	1.00
34_R	59_D	2.231	1.00
38_T	48_G	2.201	1.00
55_V	70_V	2.166	1.00
12_T	85_D	1.984	1.00
82_G	97_V	1.873	1.00
63_E	66_G	1.841	1.00
88_E	93_S	1.753	1.00
20_K	66_G	1.708	1.00
20_K	24_A	1.638	1.00
32_K	68_G	1.516	1.00
13_D	64_K	1.489	1.00
45_F	78_Y	1.483	1.00
40_G	90_L	1.402	1.00
55_V	61_T	1.392	1.00
52_D	56_N	1.379	1.00
14_A	85_D	1.285	1.00
87_T	96_I	1.246	1.00
11_F	19_V	1.212	1.00
104_S	113_S	1.212	1.00
19_V	33_L	1.174	1.00
17_N	20_K	1.168	1.00
52_D	55_V	1.158	1.00
26_E	31_L	1.154	1.00
35_V	79_L	1.138	1.00
13_D	17_N	1.120	1.00
60_M	73_P	1.102	1.00
77_Q	80_V	1.072	1.00
89_G	96_I	1.065	1.00
18_K	95_F	1.064	1.00
8_P	80_V	1.045	1.00
16_A	67_V	1.018	1.00
74_M	77_Q	1.012	0.99
82_G	110_S	0.999	0.99
39_G	43_S	0.966	0.99
24_A	27_D	0.961	0.99
18_K	22_L	0.937	0.99
62_I	76_L	0.932	0.99
87_T	92_G	0.927	0.99
14_A	17_N	0.917	0.99
73_P	77_Q	0.906	0.99
89_G	94_R	0.888	0.99
16_A	64_K	0.886	0.99
43_S	113_S	0.882	0.99
15_A	107_G	0.879	0.99
24_A	29_P	0.875	0.99
40_G	46_Q	0.855	0.98
81_G	100_P	0.846	0.98
31_L	55_V	0.832	0.98
11_F	69_L	0.831	0.98
18_K	91_E	0.827	0.98
20_K	67_V	0.825	0.98
103_K	113_S	0.814	0.98
75_S	84_V	0.802	0.97
18_K	86_Y	0.788	0.97
79_L	101_N	0.786	0.97
33_L	95_F	0.782	0.97
23_I	31_L	0.781	0.97
11_F	64_K	0.781	0.97
17_N	65_Q	0.772	0.97
23_I	32_K	0.755	0.96
76_L	80_V	0.752	0.96
8_P	76_L	0.746	0.96
20_K	65_Q	0.745	0.96
26_E	53_D	0.744	0.96
27_D	30_N	0.743	0.96
35_V	84_V	0.739	0.96
23_I	30_N	0.738	0.96
11_F	95_F	0.737	0.96
11_F	16_A	0.734	0.96
34_R	52_D	0.730	0.96
40_G	102_A	0.727	0.95
36_Y	50_T	0.726	0.95
55_V	68_G	0.725	0.95
87_T	94_R	0.721	0.95
32_K	55_V	0.713	0.95
45_F	49_F	0.708	0.95
89_G	92_G	0.707	0.95
15_A	92_G	0.706	0.95
29_P	53_D	0.704	0.95
81_G	101_N	0.704	0.95
43_S	112_F	0.701	0.94
108_C	111_S	0.690	0.94
49_F	78_Y	0.688	0.94
19_V	67_V	0.684	0.94
22_L	95_F	0.683	0.94
89_G	93_S	0.681	0.94
60_M	76_L	0.681	0.94
39_G	45_F	0.679	0.93
37_I	112_F	0.671	0.93
61_T	70_V	0.667	0.93
102_A	112_F	0.657	0.92
23_I	51_F	0.655	0.92
16_A	66_G	0.654	0.92
60_M	80_V	0.641	0.91
31_L	53_D	0.637	0.91
87_T	91_E	0.632	0.91
19_V	95_F	0.626	0.90
43_S	104_S	0.625	0.90
52_D	59_D	0.622	0.90
45_F	112_F	0.620	0.90
43_S	78_Y	0.617	0.90
11_F	84_V	0.614	0.89
109_G	112_F	0.612	0.89
19_V	23_I	0.610	0.89
40_G	43_S	0.609	0.89
37_I	40_G	0.602	0.89
64_K	69_L	0.602	0.89
17_N	24_A	0.601	0.88
9_L	81_G	0.596	0.88
56_N	59_D	0.594	0.88
88_E	107_G	0.590	0.88
13_D	16_A	0.588	0.87
22_L	51_F	0.583	0.87
108_C	112_F	0.577	0.86
97_V	110_S	0.576	0.86
49_F	82_G	0.576	0.86
18_K	88_E	0.572	0.86
15_A	103_K	0.572	0.86
56_N	73_P	0.572	0.86
99_N	102_A	0.572	0.86
24_A	56_N	0.562	0.85
32_K	61_T	0.562	0.85
9_L	82_G	0.559	0.85
32_K	69_L	0.553	0.84
60_M	77_Q	0.551	0.84
47_Y	109_G	0.548	0.83
49_F	92_G	0.546	0.83
86_Y	93_S	0.545	0.83
74_M	78_Y	0.544	0.83
8_P	64_K	0.543	0.83
39_G	49_F	0.542	0.83
30_N	53_D	0.542	0.83
20_K	23_I	0.541	0.83
39_G	74_M	0.540	0.83
19_V	25_D	0.538	0.82
67_V	82_G	0.534	0.82
43_S	93_S	0.533	0.82
58_G	73_P	0.530	0.81
106_C	111_S	0.527	0.81
57_E	73_P	0.525	0.81
76_L	96_I	0.519	0.80
9_L	94_R	0.511	0.79
41_G	111_S	0.510	0.79
81_G	99_N	0.509	0.79
45_F	107_G	0.502	0.78
21_S	24_A	0.500	0.78

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2d2aA	2	0.9912	100	0.132	Contact Map
1nwbA	1	0.8772	100	0.159	Contact Map
2apnA	1	1	100	0.167	Contact Map
1x0gA	4	0.9386	100	0.17	Contact Map
1r94A	3	0.8509	100	0.175	Contact Map
2k4zA	1	0.9298	100	0.338	Contact Map
2p2eA	1	0.9035	99.9	0.47	Contact Map
2qgoA	1	0.7719	99.8	0.489	Contact Map
3butA	2	0.3246	12.7	0.932	Contact Map
4dapA	1	0.7544	8.3	0.937	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.