GLRX4 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GLRX4 - Glutaredoxin-4

UniProt:	P0AC69	Sequences: MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12181
Length:	115 (99)
Sequences:	1988 (966)
Seq/√Len:	97.1

ECOLI - GLRX4 GLRX3
HALSA - Q9HS15

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
16_P	77_D	3.399	1.00
9_Q	13_A	3.302	1.00
19_L	74_L	3.127	1.00
11_Q	20_Y	2.865	1.00
51_D	54_Q	2.848	1.00
25_P	49_Y	2.756	1.00
35_Q	88_I	2.522	1.00
62_L	71_F	2.520	1.00
36_A	87_V	2.463	1.00
41_A	47_F	2.406	1.00
9_Q	65_Y	2.251	1.00
60_A	64_K	2.222	1.00
56_P	60_A	1.939	1.00
66_A	75_W	1.872	1.00
36_A	84_C	1.855	1.00
10_R	14_E	1.820	1.00
18_L	48_A	1.812	1.00
43_C	91_Y	1.649	1.00
24_S	51_D	1.624	1.00
29_S	51_D	1.606	1.00
7_K	55_N	1.527	1.00
18_L	50_V	1.497	1.00
52_I	71_F	1.434	1.00
5_I	9_Q	1.424	1.00
76_V	99_L	1.422	1.00
7_K	11_Q	1.409	0.99
84_C	88_I	1.342	0.99
74_L	87_V	1.299	0.99
15_N	48_A	1.280	0.99
11_Q	48_A	1.245	0.99
71_F	80_L	1.243	0.99
19_L	36_A	1.238	0.99
90_M	99_L	1.235	0.99
42_A	91_Y	1.229	0.99
97_Q	101_K	1.225	0.99
98_Q	102_E	1.197	0.98
39_A	87_V	1.187	0.98
6_E	10_R	1.182	0.98
35_Q	84_C	1.100	0.97
5_I	64_K	1.091	0.97
52_I	62_L	1.082	0.97
36_A	74_L	1.074	0.97
66_A	80_L	1.069	0.97
38_Q	42_A	1.063	0.96
4_T	8_I	1.057	0.96
21_M	33_S	1.028	0.96
4_T	7_K	1.023	0.96
65_Y	75_W	0.982	0.95
91_Y	97_Q	0.979	0.94
17_I	45_E	0.971	0.94
11_Q	50_V	0.967	0.94
88_I	92_Q	0.962	0.94
25_P	47_F	0.934	0.93
21_M	36_A	0.932	0.93
39_A	88_I	0.929	0.93
15_N	50_V	0.910	0.92
81_V	99_L	0.909	0.92
5_I	61_E	0.908	0.92
43_C	97_Q	0.903	0.92
89_E	93_R	0.900	0.92
34_A	38_Q	0.856	0.89
8_I	12_I	0.844	0.89
66_A	73_Q	0.831	0.88
45_E	100_I	0.829	0.88
39_A	84_C	0.826	0.88
14_E	48_A	0.824	0.88
76_V	100_I	0.823	0.87
11_Q	18_L	0.813	0.87
24_S	27_L	0.810	0.87
6_E	9_Q	0.805	0.86
59_R	68_W	0.793	0.85
91_Y	96_L	0.789	0.85
22_K	30_C	0.780	0.85
23_G	28_P	0.766	0.83
77_D	102_E	0.763	0.83
24_S	49_Y	0.749	0.82
12_I	78_G	0.745	0.82
40_L	74_L	0.739	0.81
60_A	89_E	0.710	0.79
55_N	75_W	0.703	0.78
61_E	64_K	0.702	0.78
39_A	91_Y	0.698	0.77
65_Y	73_Q	0.690	0.77
22_K	59_R	0.681	0.76
99_L	102_E	0.674	0.75
81_V	90_M	0.674	0.75
34_A	84_C	0.673	0.75
50_V	58_I	0.670	0.74
54_Q	57_D	0.667	0.74
24_S	54_Q	0.665	0.74
76_V	81_V	0.654	0.73
17_I	100_I	0.654	0.73
45_E	101_K	0.650	0.72
69_P	86_I	0.649	0.72
12_I	65_Y	0.649	0.72
39_A	43_C	0.631	0.70
35_Q	91_Y	0.630	0.70
29_S	56_P	0.626	0.69
90_M	96_L	0.626	0.69
97_Q	102_E	0.624	0.69
26_K	41_A	0.620	0.69
9_Q	12_I	0.618	0.68
57_D	61_E	0.610	0.67
34_A	50_V	0.605	0.67
22_K	32_F	0.604	0.67
25_P	41_A	0.599	0.66
70_T	85_D	0.597	0.66
5_I	12_I	0.595	0.65
84_C	87_V	0.594	0.65
4_T	61_E	0.593	0.65
63_P	75_W	0.589	0.65
25_P	48_A	0.589	0.65
95_E	99_L	0.587	0.64
7_K	20_Y	0.585	0.64
90_M	95_E	0.583	0.64
42_A	92_Q	0.579	0.63
22_K	33_S	0.578	0.63
34_A	43_C	0.575	0.63
34_A	37_V	0.568	0.62
53_L	59_R	0.568	0.62
35_Q	39_A	0.563	0.61
93_R	98_Q	0.561	0.61
48_A	58_I	0.559	0.61
27_L	34_A	0.558	0.61
34_A	88_I	0.557	0.60
73_Q	83_G	0.555	0.60
11_Q	58_I	0.553	0.60
38_Q	41_A	0.552	0.60
98_Q	101_K	0.550	0.59
21_M	59_R	0.545	0.59
37_V	41_A	0.545	0.59
32_F	85_D	0.544	0.59
60_A	63_P	0.538	0.58
86_I	96_L	0.536	0.58
64_K	67_N	0.528	0.56
23_G	30_C	0.527	0.56
82_G	85_D	0.526	0.56
35_Q	42_A	0.526	0.56
60_A	71_F	0.523	0.56
81_V	102_E	0.523	0.56
32_F	44_G	0.519	0.55
6_E	86_I	0.518	0.55
12_I	66_A	0.509	0.54
10_R	24_S	0.508	0.54
20_Y	89_E	0.502	0.53
9_Q	78_G	0.501	0.53
63_P	71_F	0.500	0.52
32_F	69_P	0.500	0.52

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2wciA	3	0.9826	99.9	0.445	Contact Map
2jadA	1	0.8609	99.9	0.496	Contact Map
2wulA	3	0.9304	99.8	0.519	Contact Map
3gx8A	1	0.9391	99.8	0.524	Contact Map
1wikA	1	0.9478	99.8	0.535	Contact Map
2yanA	1	0.8957	99.8	0.537	Contact Map
3ipzA	3	0.9217	99.8	0.538	Contact Map
3zywA	1	0.9565	99.8	0.55	Contact Map
2ltkA	1	0.9565	99.7	0.582	Contact Map
1u6tA	1	0.8261	99.7	0.585	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.