GLRX3 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GLRX3 - Glutaredoxin-3

UniProt:	P0AC62	Sequences: MANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDPLLK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12294
Length:	83 (81)
Sequences:	2405 (1409)
Seq/√Len:	156.5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
66_C	70_Y	3.710	1.00
23_S	29_F	3.040	1.00
19_K	31_E	2.195	1.00
25_K	79_D	2.127	1.00
25_K	73_D	2.099	1.00
10_E	33_P	2.018	1.00
3_N	59_D	1.956	1.00
40_K	43_E	1.955	1.00
50_R	55_Q	1.893	1.00
56_I	69_L	1.764	1.00
20_A	24_S	1.663	1.00
4_V	27_V	1.660	1.00
10_E	35_D	1.628	1.00
17_R	66_C	1.568	1.00
5_E	47_R	1.568	1.00
55_Q	62_H	1.557	1.00
43_E	47_R	1.475	1.00
50_R	62_H	1.473	1.00
5_E	32_L	1.456	1.00
8_T	31_E	1.450	1.00
6_I	56_I	1.416	1.00
17_R	70_Y	1.413	1.00
18_A	66_C	1.391	1.00
8_T	19_K	1.379	1.00
18_A	69_L	1.326	1.00
33_P	36_G	1.302	1.00
45_I	51_T	1.247	1.00
21_L	66_C	1.224	1.00
61_Q	81_L	1.216	1.00
9_K	53_V	1.186	1.00
17_R	67_D	1.184	1.00
34_I	53_V	1.181	1.00
58_I	63_I	1.163	1.00
77_G	80_P	1.152	1.00
9_K	34_I	1.147	1.00
5_E	30_Q	1.113	1.00
18_A	56_I	1.092	0.99
61_Q	77_G	1.075	0.99
58_I	81_L	1.054	0.99
16_H	20_A	1.022	0.99
42_E	45_I	1.009	0.99
17_R	20_A	1.009	0.99
20_A	23_S	1.007	0.99
75_R	80_P	0.989	0.99
42_E	51_T	0.985	0.99
72_L	77_G	0.975	0.99
3_N	30_Q	0.974	0.99
44_M	53_V	0.972	0.99
21_L	70_Y	0.956	0.99
50_R	68_D	0.929	0.98
21_L	73_D	0.921	0.98
43_E	46_K	0.916	0.98
73_D	78_L	0.912	0.98
6_I	18_A	0.908	0.98
71_A	75_R	0.907	0.98
21_L	25_K	0.889	0.98
42_E	46_K	0.884	0.98
7_Y	60_A	0.878	0.97
73_D	79_D	0.871	0.97
37_N	40_K	0.848	0.97
50_R	67_D	0.838	0.97
63_I	81_L	0.832	0.96
24_S	73_D	0.827	0.96
9_K	52_T	0.819	0.96
48_S	55_Q	0.814	0.96
63_I	72_L	0.812	0.96
48_S	57_F	0.806	0.96
9_K	13_P	0.775	0.95
6_I	22_L	0.770	0.95
38_A	42_E	0.766	0.94
70_Y	74_A	0.766	0.94
6_I	31_E	0.760	0.94
5_E	60_A	0.755	0.94
13_P	16_H	0.745	0.94
22_L	27_V	0.730	0.93
68_D	71_A	0.728	0.93
37_N	44_M	0.717	0.92
9_K	41_R	0.707	0.92
9_K	33_P	0.706	0.92
78_L	82_L	0.701	0.91
39_A	42_E	0.699	0.91
67_D	70_Y	0.697	0.91
3_N	60_A	0.696	0.91
11_T	16_H	0.694	0.91
8_T	11_T	0.686	0.91
21_L	69_L	0.684	0.90
15_C	53_V	0.677	0.90
69_L	72_L	0.677	0.90
41_R	44_M	0.672	0.90
36_G	40_K	0.666	0.89
39_A	43_E	0.662	0.89
72_L	80_P	0.658	0.89
9_K	35_D	0.634	0.87
59_D	80_P	0.634	0.87
44_M	48_S	0.633	0.87
6_I	29_F	0.632	0.87
41_R	51_T	0.627	0.86
7_Y	40_K	0.620	0.86
38_A	51_T	0.613	0.85
23_S	28_S	0.603	0.84
44_M	47_R	0.600	0.84
4_V	82_L	0.589	0.83
73_D	80_P	0.587	0.82
48_S	62_H	0.585	0.82
40_K	48_S	0.577	0.81
41_R	45_I	0.576	0.81
19_K	33_P	0.573	0.81
34_I	44_M	0.573	0.81
8_T	33_P	0.571	0.81
14_Y	67_D	0.570	0.80
21_L	27_V	0.567	0.80
69_L	73_D	0.558	0.79
10_E	40_K	0.549	0.78
7_Y	32_L	0.541	0.77
58_I	61_Q	0.540	0.77
65_G	69_L	0.533	0.76
10_E	34_I	0.530	0.75
62_H	72_L	0.530	0.75
11_T	36_G	0.527	0.75
15_C	49_G	0.506	0.72
62_H	67_D	0.506	0.72
22_L	59_D	0.500	0.71

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2jadA	1	1	99.9	0.235	Contact Map
1u6tA	1	0.9759	99.9	0.285	Contact Map
2wciA	3	1	99.9	0.32	Contact Map
1t1vA	2	1	99.9	0.335	Contact Map
2ct6A	1	0.988	99.9	0.344	Contact Map
2wulA	3	1	99.9	0.362	Contact Map
3gx8A	1	1	99.9	0.365	Contact Map
1wikA	1	1	99.8	0.381	Contact Map
2yanA	1	1	99.8	0.383	Contact Map
3zywA	1	1	99.8	0.384	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.