HCAC - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HCAC - 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit

UniProt:	P0ABW0	Sequences: MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATVECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGGDIFIDLPEAQP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13458
Length:	106 (98)
Sequences:	2519 (1723)
Seq/√Len:	174.0

ECOLI - HCAC YEAW
BACSU - NASE
SULSO - Q97YS8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_Y	96_D	4.453	1.00
9_V	35_F	2.681	1.00
38_I	85_L	2.569	1.00
3_R	91_H	2.351	1.00
5_Y	98_F	2.195	1.00
58_A	70_C	2.002	1.00
40_D	50_S	1.979	1.00
67_A	81_A	1.951	1.00
58_A	72_K	1.908	1.00
47_A	63_P	1.820	1.00
8_P	96_D	1.817	1.00
91_H	98_F	1.816	1.00
14_E	30_N	1.811	1.00
34_E	72_K	1.724	1.00
75_K	84_P	1.670	1.00
29_F	38_I	1.600	1.00
39_N	86_T	1.598	1.00
93_E	98_F	1.582	1.00
89_P	100_D	1.547	1.00
5_Y	8_P	1.541	1.00
8_P	11_D	1.537	1.00
54_L	71_L	1.523	1.00
70_C	73_T	1.523	1.00
17_A	29_F	1.514	1.00
17_A	27_A	1.471	1.00
25_V	40_D	1.411	1.00
24_P	39_N	1.388	1.00
26_I	37_A	1.383	1.00
47_A	64_L	1.362	1.00
30_N	33_G	1.347	1.00
59_T	77_L	1.347	1.00
76_A	84_P	1.296	1.00
40_D	48_S	1.273	1.00
67_A	76_A	1.264	1.00
11_D	18_L	1.243	1.00
59_T	68_S	1.224	1.00
39_N	88_Y	1.215	1.00
14_E	33_G	1.192	1.00
41_R	46_N	1.157	1.00
9_V	92_V	1.139	1.00
17_A	54_L	1.127	1.00
9_V	95_G	1.099	1.00
36_Y	72_K	1.088	1.00
31_V	34_E	1.088	1.00
31_V	58_A	1.081	1.00
35_F	90_V	1.074	1.00
30_N	35_F	1.065	1.00
8_P	95_G	1.033	0.99
10_A	95_G	1.012	0.99
67_A	84_P	1.010	0.99
49_M	85_L	1.005	0.99
17_A	60_V	1.003	0.99
76_A	81_A	1.001	0.99
7_C	12_V	0.997	0.99
21_D	25_V	0.995	0.99
43_S	67_A	0.986	0.99
45_G	67_A	0.985	0.99
43_S	85_L	0.985	0.99
19_R	25_V	0.967	0.99
7_C	28_L	0.958	0.99
13_P	16_E	0.952	0.99
19_R	40_D	0.924	0.99
35_F	92_V	0.920	0.99
3_R	100_D	0.914	0.99
43_S	69_F	0.903	0.99
76_A	79_L	0.902	0.99
15_G	30_N	0.895	0.98
27_A	38_I	0.892	0.98
19_R	50_S	0.890	0.98
19_R	48_S	0.886	0.98
14_E	32_G	0.882	0.98
6_A	99_I	0.875	0.98
68_S	78_C	0.860	0.98
92_V	97_I	0.857	0.98
29_F	71_L	0.855	0.98
29_F	60_V	0.847	0.98
28_L	35_F	0.843	0.98
38_I	87_T	0.840	0.98
81_A	84_P	0.831	0.97
13_P	30_N	0.825	0.97
70_C	77_L	0.812	0.97
24_P	88_Y	0.811	0.97
27_A	50_S	0.798	0.97
46_N	64_L	0.793	0.97
34_E	58_A	0.779	0.96
36_Y	87_T	0.770	0.96
41_R	48_S	0.758	0.96
7_C	97_I	0.755	0.96
45_G	64_L	0.752	0.95
31_V	36_Y	0.752	0.95
53_Y	61_E	0.744	0.95
32_G	58_A	0.742	0.95
43_S	81_A	0.719	0.94
13_P	17_A	0.709	0.94
38_I	71_L	0.699	0.93
43_S	84_P	0.697	0.93
55_E	61_E	0.678	0.92
12_V	16_E	0.661	0.91
40_D	85_L	0.660	0.91
64_L	82_T	0.659	0.91
25_V	39_N	0.657	0.91
31_V	56_D	0.656	0.91
35_F	97_I	0.648	0.90
23_S	100_D	0.645	0.90
31_V	71_L	0.643	0.90
61_E	68_S	0.637	0.90
67_A	82_T	0.635	0.90
7_C	18_L	0.634	0.89
64_L	79_L	0.622	0.89
3_R	98_F	0.620	0.88
68_S	77_L	0.618	0.88
3_R	93_E	0.614	0.88
26_I	99_I	0.593	0.86
37_A	99_I	0.591	0.86
88_Y	100_D	0.587	0.86
12_V	35_F	0.585	0.85
20_I	28_L	0.581	0.85
25_V	41_R	0.578	0.85
12_V	97_I	0.573	0.84
6_A	37_A	0.564	0.83
67_A	79_L	0.564	0.83
45_G	81_A	0.563	0.83
4_I	22_T	0.560	0.83
79_L	82_T	0.557	0.82
93_E	96_D	0.556	0.82
54_L	61_E	0.550	0.82
12_V	18_L	0.549	0.82
27_A	40_D	0.547	0.81
39_N	85_L	0.547	0.81
59_T	78_C	0.547	0.81
70_C	75_K	0.545	0.81
7_C	22_T	0.544	0.81
89_P	101_L	0.541	0.81
67_A	78_C	0.533	0.80
55_E	68_S	0.532	0.80
56_D	59_T	0.526	0.79
73_T	87_T	0.525	0.79
53_Y	66_A	0.515	0.77
48_S	64_L	0.515	0.77
27_A	85_L	0.514	0.77
45_G	68_S	0.513	0.77
78_C	82_T	0.512	0.77
46_N	66_A	0.510	0.77
67_A	83_D	0.510	0.77
6_A	20_I	0.508	0.76
29_F	47_A	0.506	0.76
12_V	61_E	0.500	0.75

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2i7fA	1	0.934	100	0.269	Contact Map
1fqtA	2	0.9906	100	0.269	Contact Map
3gceA	1	0.9434	100	0.278	Contact Map
2qpzA	1	0.9528	100	0.281	Contact Map
3dqyA	1	0.9811	100	0.285	Contact Map
2de6D	1	0.9528	100	0.286	Contact Map
1vm9A	1	0.9717	100	0.288	Contact Map
2jzaA	1	0.9811	100	0.297	Contact Map
2jo6A	1	0.9528	100	0.303	Contact Map
3c0dA	1	0.9623	100	0.308	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.