CYNT - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CYNT - Carbonic anhydrase 1

UniProt:	P0ABE9	Sequences: MKEIIDGFLKFQREAFPKREALFKQLATQQSPRTLFISCSDSRLVPELVTQREPGDLFVIRNAGNIVPSYGPEPGGVSASVEYAVAALRVSDIVICGHSNCGAMTAIASCQCMDHMPAVSHWLRYADSARVVNEARPHSDLPSKAAAMVRENVIAQLANLQTHPSVRLALEEGRIALHGWVYDIESGSIAAFDGATRQFVPLAANPRVCAIPLRQPTAA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10176
Length:	219 (188)
Sequences:	4065 (2473)
Seq/√Len:	180.4

ECOLI - CYNT CAN
BACSU - YVDA YTIB YBCF
HALSA - Q9HR64
SULSO - Q97YU3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
153_V	179_G	4.724	1.00
161_Q	170_L	4.104	1.00
33_R	91_S	4.080	1.00
157_L	179_G	3.113	1.00
64_G	103_A	2.981	1.00
167_R	171_E	2.701	1.00
157_L	177_L	2.641	1.00
2_K	6_D	2.616	1.00
35_L	81_V	2.438	1.00
92_D	178_H	2.372	1.00
105_T	109_S	2.254	1.00
82_E	86_A	2.248	1.00
168_L	172_E	2.196	1.00
99_S	181_V	2.193	1.00
150_R	190_A	2.178	1.00
105_T	145_A	2.169	1.00
149_V	181_V	2.157	1.00
63_A	80_S	2.119	1.00
30_Q	42_S	2.047	1.00
5_I	191_A	2.011	1.00
40_S	58_F	1.895	1.00
180_W	189_I	1.886	1.00
6_D	10_K	1.872	1.00
10_K	51_Q	1.844	1.00
169_A	174_R	1.821	1.00
85_V	169_A	1.813	1.00
78_S	163_H	1.791	1.00
84_A	90_V	1.774	1.00
85_V	166_V	1.761	1.00
183_D	190_A	1.754	1.00
50_T	57_L	1.709	1.00
9_L	13_R	1.701	1.00
83_Y	87_A	1.683	1.00
89_R	169_A	1.661	1.00
9_L	188_S	1.646	1.00
22_L	25_Q	1.585	1.00
150_R	181_V	1.574	1.00
35_L	80_S	1.553	1.00
35_L	90_V	1.549	1.00
136_R	139_S	1.537	1.00
30_Q	102_G	1.530	1.00
183_D	186_S	1.502	1.00
81_V	160_L	1.480	1.00
161_Q	177_L	1.479	1.00
66_I	126_A	1.474	1.00
100_N	185_E	1.465	1.00
6_D	9_L	1.461	1.00
108_A	148_M	1.438	1.00
60_I	80_S	1.428	1.00
153_V	157_L	1.393	1.00
7_G	51_Q	1.390	1.00
133_N	151_E	1.362	1.00
151_E	154_I	1.338	1.00
107_I	126_A	1.332	1.00
19_R	22_L	1.317	1.00
129_A	155_A	1.314	1.00
92_D	176_A	1.311	1.00
62_N	65_N	1.303	1.00
65_N	152_N	1.285	1.00
89_R	174_R	1.277	1.00
10_K	14_E	1.274	1.00
140_D	143_S	1.245	1.00
35_L	93_I	1.228	1.00
159_N	162_T	1.218	1.00
169_A	175_I	1.216	1.00
68_P	76_G	1.207	1.00
99_S	183_D	1.204	1.00
166_V	175_I	1.188	1.00
104_M	126_A	1.177	1.00
8_F	12_Q	1.160	1.00
124_R	127_D	1.156	1.00
146_A	150_R	1.149	1.00
67_V	77_V	1.133	1.00
85_V	90_V	1.127	1.00
127_D	130_R	1.110	1.00
96_C	180_W	1.095	1.00
19_R	25_Q	1.093	1.00
91_S	174_R	1.092	1.00
94_V	180_W	1.088	1.00
180_W	191_A	1.088	1.00
83_Y	102_G	1.085	1.00
100_N	105_T	1.084	1.00
36_F	96_C	1.070	1.00
87_A	116_M	1.057	1.00
132_V	151_E	1.044	1.00
86_A	168_L	1.039	1.00
21_A	24_K	1.036	1.00
37_I	81_V	1.033	1.00
142_P	146_A	1.029	1.00
108_A	145_A	1.022	0.99
154_I	192_F	0.988	0.99
50_T	180_W	0.978	0.99
40_S	88_L	0.973	0.99
38_S	44_L	0.970	0.99
38_S	96_C	0.961	0.99
63_A	103_A	0.959	0.99
109_S	141_L	0.957	0.99
40_S	60_I	0.941	0.99
191_A	194_G	0.935	0.99
77_V	81_V	0.934	0.99
52_R	57_L	0.932	0.99
186_S	190_A	0.931	0.99
125_Y	128_S	0.927	0.99
27_A	100_N	0.921	0.99
21_A	25_Q	0.921	0.99
31_S	89_R	0.908	0.99
138_H	141_L	0.904	0.99
155_A	158_A	0.898	0.99
110_C	127_D	0.895	0.99
7_G	10_K	0.894	0.99
36_F	50_T	0.889	0.99
47_E	52_R	0.889	0.99
104_M	148_M	0.879	0.98
116_M	119_V	0.876	0.98
7_G	11_F	0.874	0.98
42_S	102_G	0.871	0.98
116_M	120_S	0.853	0.98
141_L	144_K	0.851	0.98
145_A	149_V	0.848	0.98
45_V	49_V	0.845	0.98
47_E	57_L	0.844	0.98
104_M	149_V	0.842	0.98
14_E	51_Q	0.839	0.98
5_I	189_I	0.839	0.98
67_V	156_Q	0.839	0.98
141_L	145_A	0.838	0.98
4_I	50_T	0.837	0.98
85_V	93_I	0.822	0.98
3_E	7_G	0.820	0.98
152_N	156_Q	0.817	0.97
151_E	155_A	0.817	0.97
68_P	77_V	0.813	0.97
97_G	153_V	0.810	0.97
65_N	156_Q	0.809	0.97
29_Q	100_N	0.804	0.97
12_Q	188_S	0.798	0.97
30_Q	58_F	0.785	0.97
126_A	129_A	0.783	0.97
102_G	119_V	0.782	0.97
147_A	151_E	0.778	0.97
154_I	179_G	0.777	0.97
143_S	147_A	0.777	0.97
69_S	118_A	0.776	0.97
60_I	77_V	0.773	0.96
86_A	165_S	0.773	0.96
34_T	91_S	0.773	0.96
24_K	27_A	0.770	0.96
67_V	78_S	0.766	0.96
132_V	155_A	0.764	0.96
144_K	148_M	0.758	0.96
78_S	118_A	0.755	0.96
136_R	140_D	0.754	0.96
86_A	169_A	0.751	0.96
153_V	181_V	0.751	0.96
19_R	53_E	0.750	0.96
87_A	119_V	0.742	0.96
20_E	23_F	0.741	0.96
52_R	56_D	0.738	0.95
14_E	18_K	0.728	0.95
58_F	102_G	0.723	0.95
50_T	96_C	0.723	0.95
142_P	147_A	0.723	0.95
16_F	21_A	0.715	0.95
160_L	166_V	0.714	0.95
108_A	144_K	0.712	0.94
69_S	125_Y	0.710	0.94
45_V	59_V	0.709	0.94
19_R	23_F	0.708	0.94
76_G	79_A	0.707	0.94
158_A	161_Q	0.706	0.94
143_S	146_A	0.702	0.94
75_G	79_A	0.701	0.94
15_A	48_L	0.698	0.94
160_L	177_L	0.697	0.94
127_D	131_V	0.696	0.94
102_G	106_A	0.687	0.93
146_A	149_V	0.684	0.93
34_T	92_D	0.684	0.93
46_P	59_V	0.680	0.93
134_E	144_K	0.679	0.93
12_Q	16_F	0.677	0.93
147_A	150_R	0.677	0.93
83_Y	88_L	0.674	0.93
146_A	183_D	0.670	0.92
131_V	134_E	0.666	0.92
146_A	181_V	0.666	0.92
23_F	54_P	0.666	0.92
69_S	121_H	0.665	0.92
25_Q	53_E	0.664	0.92
117_P	120_S	0.661	0.92
4_I	36_F	0.659	0.92
130_R	148_M	0.658	0.92
47_E	59_V	0.657	0.92
46_P	54_P	0.656	0.92
65_N	97_G	0.652	0.91
125_Y	129_A	0.651	0.91
125_Y	159_N	0.651	0.91
62_N	76_G	0.651	0.91
132_V	158_A	0.650	0.91
105_T	108_A	0.647	0.91
25_Q	29_Q	0.647	0.91
104_M	107_I	0.646	0.91
94_V	178_H	0.645	0.91
3_E	33_R	0.641	0.91
76_G	122_W	0.637	0.90
181_V	190_A	0.636	0.90
37_I	67_V	0.633	0.90
38_S	81_V	0.633	0.90
15_A	53_E	0.626	0.90
99_S	184_I	0.625	0.90
177_L	194_G	0.624	0.90
126_A	130_R	0.616	0.89
82_E	118_A	0.616	0.89
24_K	28_T	0.615	0.89
118_A	121_H	0.614	0.89
100_N	142_P	0.609	0.88
133_N	147_A	0.609	0.88
58_F	84_A	0.608	0.88
34_T	94_V	0.602	0.88
34_T	82_E	0.602	0.88
121_H	125_Y	0.601	0.88
94_V	191_A	0.599	0.88
15_A	18_K	0.597	0.87
40_S	83_Y	0.594	0.87
83_Y	105_T	0.592	0.87
62_N	122_W	0.591	0.87
146_A	185_E	0.591	0.87
170_L	176_A	0.589	0.87
169_A	172_E	0.586	0.86
157_L	161_Q	0.584	0.86
164_P	168_L	0.582	0.86
82_E	187_G	0.578	0.86
22_L	53_E	0.578	0.86
166_V	169_A	0.578	0.86
16_F	23_F	0.575	0.85
121_H	124_R	0.575	0.85
46_P	57_L	0.573	0.85
76_G	90_V	0.572	0.85
78_S	160_L	0.568	0.85
27_A	184_I	0.565	0.84
48_L	54_P	0.564	0.84
138_H	144_K	0.563	0.84
129_A	151_E	0.563	0.84
33_R	52_R	0.559	0.84
118_A	163_H	0.555	0.83
5_I	94_V	0.555	0.83
119_V	164_P	0.551	0.83
180_W	192_F	0.550	0.83
106_A	119_V	0.547	0.83
107_I	130_R	0.546	0.82
164_P	167_R	0.544	0.82
112_C	168_L	0.544	0.82
3_E	52_R	0.543	0.82
39_C	101_C	0.543	0.82
165_S	168_L	0.541	0.82
93_I	166_V	0.540	0.82
62_N	77_V	0.538	0.81
38_S	46_P	0.538	0.81
178_H	191_A	0.536	0.81
59_V	62_N	0.536	0.81
83_Y	119_V	0.533	0.81
108_A	130_R	0.533	0.81
85_V	175_I	0.532	0.81
35_L	84_A	0.530	0.81
107_I	127_D	0.529	0.80
36_F	46_P	0.526	0.80
121_H	164_P	0.526	0.80
131_V	155_A	0.525	0.80
104_M	152_N	0.525	0.80
36_F	57_L	0.524	0.80
7_G	194_G	0.522	0.80
63_A	79_A	0.517	0.79
118_A	164_P	0.516	0.79
8_F	189_I	0.515	0.79
96_C	182_Y	0.512	0.78
37_I	46_P	0.509	0.78
16_F	20_E	0.509	0.78
98_H	101_C	0.507	0.78
67_V	159_N	0.505	0.77
38_S	45_V	0.505	0.77
39_C	98_H	0.502	0.77
136_R	144_K	0.500	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ddzA	2	0.9726	100	0.169	Contact Map
3qy1A	4	0.9543	100	0.17	Contact Map
4rxyA	4	0.9361	100	0.171	Contact Map
3e3iA	6	0.9361	100	0.175	Contact Map
2w3qA	2	0.8584	100	0.176	Contact Map
4o1kA	4	0.9269	100	0.183	Contact Map
1ekjA	5	0.9315	100	0.187	Contact Map
4o1jA	4	0.8767	100	0.187	Contact Map
3eyxA	2	0.8676	100	0.201	Contact Map
3ucjA	4	0.968	100	0.202	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0128 seconds.