BFR - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BFR - Bacterioferritin

UniProt:	P0ABD3	Sequences: MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10113
Length:	158 (147)
Sequences:	1674 (886)
Seq/√Len:	73.1

ECOLI - BFR
SULSO - DPS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
84_E	88_R	3.931	1.00
57_R	122_E	3.546	1.00
37_L	150_L	3.068	1.00
4_D	111_V	2.951	1.00
107_Y	111_V	2.795	1.00
82_D	85_E	2.598	1.00
88_R	92_A	2.530	1.00
32_F	86_M	2.479	1.00
6_K	9_N	2.326	1.00
98_A	102_R	2.289	1.00
78_N	92_A	2.138	1.00
6_K	111_V	2.006	1.00
139_D	143_K	1.995	1.00
98_A	131_I	1.967	1.00
30_R	56_D	1.919	1.00
84_E	142_Q	1.916	1.00
16_G	20_V	1.861	1.00
141_I	146_L	1.842	1.00
10_Y	107_Y	1.777	1.00
91_L	135_E	1.776	1.00
50_D	53_K	1.725	1.00
49_I	52_M	1.675	1.00
33_K	60_E	1.657	1.00
42_D	46_H	1.625	0.99
118_D	121_I	1.604	0.99
84_E	146_L	1.572	0.99
12_N	67_G	1.554	0.99
106_G	110_S	1.529	0.99
99_K	103_E	1.529	0.99
15_L	62_I	1.526	0.99
104_A	120_M	1.491	0.99
144_M	150_L	1.458	0.99
14_L	101_L	1.446	0.99
78_N	96_D	1.443	0.99
51_E	130_H	1.433	0.99
98_A	127_E	1.428	0.99
62_I	67_G	1.413	0.99
109_D	117_R	1.401	0.98
50_D	126_D	1.385	0.98
59_I	71_L	1.383	0.98
43_V	46_H	1.380	0.98
84_E	138_L	1.366	0.98
25_Y	94_E	1.364	0.98
22_I	52_M	1.327	0.98
6_K	107_Y	1.307	0.98
34_N	66_E	1.295	0.97
5_T	9_N	1.288	0.97
26_F	29_A	1.287	0.97
96_D	100_N	1.276	0.97
37_L	143_K	1.257	0.97
109_D	114_Y	1.242	0.97
105_I	121_I	1.217	0.96
13_K	100_N	1.215	0.96
7_V	108_A	1.203	0.96
48_S	52_M	1.197	0.96
54_H	130_H	1.141	0.95
10_Y	104_A	1.140	0.95
32_F	41_N	1.136	0.95
17_N	100_N	1.124	0.94
83_V	150_L	1.118	0.94
18_E	94_E	1.112	0.94
34_N	64_F	1.109	0.94
58_Y	116_S	1.098	0.93
18_E	54_H	1.095	0.93
18_E	127_E	1.087	0.93
31_M	80_G	1.086	0.93
58_Y	123_I	1.086	0.93
21_A	51_E	1.074	0.93
140_L	144_M	1.056	0.92
18_E	25_Y	1.054	0.92
10_Y	103_E	1.052	0.92
31_M	35_W	1.048	0.92
7_V	111_V	1.044	0.92
14_L	100_N	1.034	0.91
47_E	51_E	1.029	0.91
91_L	95_L	1.022	0.91
16_G	73_D	1.017	0.91
132_D	136_T	1.000	0.90
133_W	137_E	0.987	0.89
7_V	107_Y	0.985	0.89
54_H	94_E	0.981	0.89
51_E	54_H	0.967	0.88
115_V	125_R	0.967	0.88
43_V	133_W	0.964	0.88
58_Y	119_M	0.957	0.88
103_E	112_H	0.957	0.88
31_M	63_L	0.955	0.88
10_Y	100_N	0.951	0.87
45_Y	49_I	0.939	0.87
127_E	130_H	0.916	0.85
148_N	151_Q	0.903	0.84
16_G	75_G	0.900	0.84
4_D	107_Y	0.899	0.84
50_D	127_E	0.898	0.84
51_E	94_E	0.897	0.84
125_R	128_E	0.894	0.84
61_R	116_S	0.891	0.84
97_G	127_E	0.885	0.83
144_M	148_N	0.881	0.83
57_R	123_I	0.879	0.83
80_G	90_D	0.877	0.83
107_Y	110_S	0.876	0.83
28_H	90_D	0.874	0.82
21_A	54_H	0.868	0.82
26_F	56_D	0.862	0.82
13_K	103_E	0.853	0.81
95_L	131_I	0.850	0.81
21_A	24_Q	0.835	0.80
88_R	138_L	0.830	0.79
41_N	45_Y	0.827	0.79
54_H	127_E	0.820	0.78
103_E	107_Y	0.819	0.78
29_A	45_Y	0.818	0.78
44_E	50_D	0.818	0.78
14_L	58_Y	0.808	0.77
33_K	41_N	0.808	0.77
92_A	95_L	0.803	0.77
89_S	92_A	0.801	0.77
26_F	48_S	0.799	0.76
19_L	22_I	0.795	0.76
47_E	54_H	0.789	0.76
20_V	75_G	0.780	0.75
9_N	13_K	0.779	0.75
26_F	45_Y	0.758	0.73
113_D	116_S	0.755	0.72
105_I	124_L	0.752	0.72
49_I	53_K	0.751	0.72
51_E	97_G	0.748	0.72
24_Q	90_D	0.744	0.71
106_G	112_H	0.741	0.71
91_L	131_I	0.736	0.70
97_G	126_D	0.733	0.70
143_K	150_L	0.733	0.70
22_I	48_S	0.733	0.70
82_D	146_L	0.719	0.69
117_R	121_I	0.715	0.68
16_G	86_M	0.714	0.68
88_R	142_Q	0.707	0.67
56_D	60_E	0.702	0.67
102_R	114_Y	0.694	0.66
29_A	41_N	0.693	0.66
50_D	54_H	0.690	0.65
105_I	117_R	0.683	0.65
38_K	42_D	0.677	0.64
40_L	83_V	0.670	0.63
58_Y	120_M	0.668	0.63
32_F	44_E	0.665	0.63
109_D	151_Q	0.665	0.63
17_N	97_G	0.664	0.62
68_L	81_E	0.663	0.62
52_M	56_D	0.660	0.62
30_R	60_E	0.648	0.61
26_F	52_M	0.646	0.60
84_E	141_I	0.642	0.60
93_L	131_I	0.640	0.60
45_Y	56_D	0.634	0.59
136_T	139_D	0.629	0.58
46_H	50_D	0.627	0.58
108_A	120_M	0.626	0.58
25_Y	54_H	0.621	0.57
18_E	97_G	0.613	0.56
94_E	130_H	0.607	0.56
33_K	45_Y	0.604	0.55
49_I	56_D	0.602	0.55
105_I	120_M	0.601	0.55
64_F	132_D	0.596	0.54
85_E	88_R	0.594	0.54
18_E	130_H	0.593	0.54
93_L	101_L	0.593	0.54
30_R	59_I	0.593	0.54
71_L	76_K	0.585	0.53
54_H	126_D	0.580	0.52
70_N	81_E	0.579	0.52
70_N	74_L	0.579	0.52
17_N	47_E	0.577	0.52
47_E	134_L	0.575	0.52
115_V	128_E	0.573	0.51
83_V	146_L	0.573	0.51
114_Y	151_Q	0.572	0.51
19_L	113_D	0.569	0.51
96_D	99_K	0.566	0.51
6_K	110_S	0.566	0.51
27_L	68_L	0.564	0.50
71_L	77_L	0.564	0.50
21_A	47_E	0.561	0.50
79_I	89_S	0.561	0.50
17_N	101_L	0.561	0.50
15_L	134_L	0.557	0.49
45_Y	48_S	0.549	0.48
32_F	83_V	0.547	0.48
137_E	149_Y	0.547	0.48
27_L	79_I	0.546	0.48
101_L	127_E	0.544	0.48
51_E	127_E	0.542	0.48
33_K	38_K	0.539	0.47
115_V	121_I	0.536	0.47
114_Y	117_R	0.535	0.47
61_R	113_D	0.534	0.47
21_A	93_L	0.533	0.46
24_Q	28_H	0.532	0.46
81_E	85_E	0.531	0.46
12_N	62_I	0.530	0.46
63_L	132_D	0.530	0.46
8_I	62_I	0.529	0.46
80_G	85_E	0.528	0.46
25_Y	130_H	0.526	0.46
23_N	132_D	0.525	0.45
102_R	151_Q	0.521	0.45
72_Q	81_E	0.514	0.44
84_E	150_L	0.513	0.44
78_N	89_S	0.512	0.44
43_V	47_E	0.511	0.44
6_K	99_K	0.509	0.44
31_M	68_L	0.508	0.43
138_L	142_Q	0.503	0.43
100_N	104_A	0.503	0.43
128_E	132_D	0.503	0.43
70_N	75_G	0.502	0.43
118_D	122_E	0.501	0.43
53_K	57_R	0.500	0.42

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4cvrA	2	0.9873	100	0.407	Contact Map
2v8tA	5	0.981	100	0.412	Contact Map
3r2kA	6	0.9684	100	0.42	Contact Map
3fvbA	6	1	100	0.422	Contact Map
4tofA	6	0.9937	100	0.423	Contact Map
1o9iA	6	0.9557	100	0.423	Contact Map
3gvyA	5	1	100	0.424	Contact Map
1jgcA	6	1	100	0.433	Contact Map
3uoiA	7	0.9937	100	0.435	Contact Map
1nfvA	7	0.9937	100	0.441	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.