ARSC - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ARSC - Arsenate reductase

UniProt:	P0AB96	Sequences: MSNITIYHNPACGTSRNTLEMIRNSGTEPTIIHYLETPPTRDELVKLIADMGISVRALLRKNVEPYEELGLAEDKFTDDRLIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLEILPDAQKGAFSKEDGEKVVDEAGKRLK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12237
Length:	141 (113)
Sequences:	3373 (2075)
Seq/√Len:	195.2

ECOLI - ARSC YFGD YFFB
BACSU - SPX MGSR YUSI

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_H	36_E	3.803	1.00
41_R	83_D	3.024	1.00
23_R	29_P	2.777	1.00
77_T	80_R	2.347	1.00
46_K	50_D	2.343	1.00
85_M	92_I	2.303	1.00
40_T	43_E	2.212	1.00
48_I	82_I	2.170	1.00
64_E	68_E	2.028	1.00
20_E	24_N	1.895	1.00
55_V	78_D	1.858	1.00
83_D	87_Q	1.819	1.00
6_I	97_V	1.768	1.00
65_P	88_H	1.719	1.00
111_V	114_E	1.705	1.00
41_R	82_I	1.698	1.00
8_H	31_I	1.697	1.00
41_R	45_V	1.695	1.00
99_T	102_G	1.613	1.00
45_V	79_D	1.606	1.00
32_I	43_E	1.601	1.00
50_D	103_T	1.567	1.00
76_F	84_F	1.562	1.00
23_R	28_E	1.550	1.00
48_I	55_V	1.504	1.00
47_L	98_V	1.493	1.00
6_I	19_L	1.472	1.00
5_T	30_T	1.464	1.00
70_G	73_E	1.428	1.00
54_S	57_A	1.416	1.00
14_T	17_N	1.404	1.00
54_S	78_D	1.379	1.00
39_P	92_I	1.356	1.00
32_I	37_T	1.355	1.00
19_L	31_I	1.304	1.00
65_P	90_I	1.276	1.00
8_H	15_S	1.268	1.00
65_P	68_E	1.237	1.00
51_M	58_L	1.237	1.00
65_P	69_L	1.229	1.00
45_V	82_I	1.207	1.00
58_L	96_I	1.202	1.00
53_I	58_L	1.197	1.00
59_L	81_L	1.196	1.00
10_P	33_H	1.190	1.00
7_Y	47_L	1.167	1.00
38_P	92_I	1.164	1.00
17_N	20_E	1.154	1.00
5_T	32_I	1.148	1.00
48_I	58_L	1.138	1.00
41_R	86_L	1.116	1.00
21_M	113_L	1.104	1.00
61_K	67_E	1.103	1.00
19_L	23_R	1.095	1.00
69_L	88_H	1.092	1.00
41_R	79_D	1.092	1.00
18_T	112_V	1.079	1.00
44_L	82_I	1.078	1.00
99_T	115_I	1.060	1.00
7_Y	32_I	1.056	1.00
51_M	96_I	1.054	1.00
56_R	66_Y	1.049	1.00
62_N	93_N	1.030	1.00
8_H	19_L	1.021	1.00
4_I	27_T	1.007	1.00
7_Y	98_V	1.001	1.00
50_D	101_L	0.994	1.00
104_R	114_E	0.982	0.99
53_I	57_A	0.981	0.99
45_V	78_D	0.967	0.99
35_L	90_I	0.959	0.99
47_L	96_I	0.946	0.99
104_R	111_V	0.938	0.99
56_R	73_E	0.918	0.99
110_E	113_L	0.912	0.99
17_N	109_S	0.904	0.99
80_R	83_D	0.891	0.99
55_V	81_L	0.886	0.99
20_E	23_R	0.886	0.99
97_V	112_V	0.885	0.99
104_R	115_I	0.883	0.99
43_E	46_K	0.877	0.99
21_M	25_S	0.873	0.99
61_K	93_N	0.863	0.99
14_T	109_S	0.857	0.99
64_E	67_E	0.856	0.99
17_N	62_N	0.846	0.98
11_A	63_V	0.835	0.98
76_F	81_L	0.834	0.98
106_C	111_V	0.832	0.98
21_M	109_S	0.830	0.98
7_Y	43_E	0.811	0.98
76_F	80_R	0.784	0.97
6_I	18_T	0.782	0.97
4_I	97_V	0.752	0.97
25_S	113_L	0.749	0.97
109_S	113_L	0.742	0.96
96_I	105_L	0.738	0.96
55_V	82_I	0.736	0.96
22_I	25_S	0.731	0.96
16_R	19_L	0.730	0.96
56_R	59_L	0.726	0.96
48_I	52_G	0.721	0.96
56_R	81_L	0.711	0.96
66_Y	71_L	0.706	0.95
21_M	107_R	0.685	0.95
72_A	76_F	0.683	0.94
93_N	106_C	0.672	0.94
30_T	37_T	0.669	0.94
24_N	27_T	0.664	0.94
54_S	81_L	0.660	0.93
47_L	103_T	0.660	0.93
18_T	111_V	0.657	0.93
48_I	78_D	0.652	0.93
11_A	16_R	0.652	0.93
39_P	43_E	0.649	0.93
59_L	85_M	0.647	0.93
66_Y	72_A	0.645	0.93
112_V	116_L	0.644	0.93
61_K	66_Y	0.643	0.92
5_T	43_E	0.643	0.92
63_V	90_I	0.633	0.92
42_D	45_V	0.627	0.92
50_D	98_V	0.626	0.91
59_L	66_Y	0.619	0.91
6_I	31_I	0.617	0.91
13_G	17_N	0.615	0.91
45_V	49_A	0.613	0.91
7_Y	39_P	0.613	0.91
111_V	115_I	0.611	0.90
69_L	91_L	0.605	0.90
66_Y	81_L	0.602	0.90
67_E	106_C	0.602	0.90
80_R	84_F	0.599	0.90
19_L	29_P	0.594	0.89
18_T	109_S	0.591	0.89
78_D	81_L	0.587	0.89
59_L	78_D	0.586	0.89
9_N	35_L	0.584	0.88
18_T	97_V	0.584	0.88
73_E	76_F	0.584	0.88
82_I	86_L	0.581	0.88
18_T	104_R	0.578	0.88
55_V	85_M	0.576	0.88
4_I	99_T	0.575	0.88
17_N	24_N	0.574	0.88
58_L	85_M	0.561	0.86
50_D	99_T	0.559	0.86
49_A	78_D	0.556	0.86
18_T	106_C	0.553	0.86
44_L	92_I	0.553	0.86
4_I	22_I	0.553	0.86
81_L	84_F	0.538	0.84
57_A	93_N	0.535	0.84
13_G	109_S	0.534	0.84
39_P	47_L	0.531	0.83
11_A	33_H	0.530	0.83
14_T	62_N	0.527	0.83
104_R	112_V	0.524	0.82
104_R	116_L	0.519	0.82
27_T	99_T	0.518	0.82
108_P	111_V	0.518	0.82
97_V	104_R	0.512	0.81
61_K	72_A	0.511	0.81
75_K	84_F	0.510	0.81
24_N	101_L	0.505	0.80
79_D	83_D	0.504	0.80
109_S	112_V	0.504	0.80
9_N	15_S	0.500	0.79
51_M	103_T	0.500	0.79

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1s3cA	2	0.9787	100	0.237	Contact Map
2mu0A	1	0.8227	100	0.355	Contact Map
1z3eA	1	0.844	100	0.364	Contact Map
3rdwA	1	0.8085	100	0.366	Contact Map
3f0iA	1	0.8156	100	0.371	Contact Map
3gkxA	2	0.8227	100	0.378	Contact Map
3l78A	1	0.8298	100	0.385	Contact Map
3fz4A	1	0.8156	100	0.386	Contact Map
2kokA	1	0.8227	100	0.395	Contact Map
2m46A	1	0.8156	100	0.41	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.