FUCA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FUCA - L-fuculose phosphate aldolase

UniProt:	P0AB87	Sequences: MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDGNGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGGNSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQLYLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10348
Length:	215 (196)
Sequences:	6336 (3788)
Seq/√Len:	270.6

ECOLI - FUCA ULAF SGBE ARAD YGBL RHAD
BACSU - ARAD MTNB
HALSA - Q9HQE3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_D	63_K	4.884	1.00
162_V	166_K	3.336	1.00
97_H	183_T	3.228	1.00
179_Q	183_T	3.122	1.00
106_R	185_L	2.801	1.00
6_L	32_V	2.676	1.00
39_L	55_I	2.557	1.00
9_Q	165_E	2.550	1.00
38_M	78_M	2.515	1.00
196_D	200_A	2.278	1.00
87_A	160_C	2.251	1.00
134_R	138_E	2.178	1.00
79_A	138_E	2.135	1.00
100_A	183_T	2.128	1.00
97_H	179_Q	2.082	1.00
96_V	179_Q	2.057	1.00
107_S	122_S	2.055	1.00
51_T	54_H	2.010	1.00
79_A	82_Q	2.009	1.00
11_I	52_E	2.001	1.00
97_H	182_L	1.946	1.00
39_L	57_F	1.931	1.00
195_S	198_E	1.912	1.00
91_V	167_A	1.890	1.00
32_V	164_L	1.865	1.00
8_R	12_D	1.835	1.00
149_A	174_V	1.830	1.00
34_Y	39_L	1.758	1.00
183_T	186_A	1.736	1.00
16_E	20_L	1.665	1.00
89_A	164_L	1.658	1.00
88_N	163_N	1.657	1.00
58_I	74_W	1.653	1.00
5_K	9_Q	1.641	1.00
163_N	166_K	1.624	1.00
10_I	30_V	1.591	1.00
127_P	153_Q	1.586	1.00
13_T	168_L	1.581	1.00
34_Y	37_G	1.542	1.00
61_N	82_Q	1.528	1.00
20_L	172_H	1.493	1.00
161_E	166_K	1.477	1.00
8_R	52_E	1.465	1.00
157_L	174_V	1.456	1.00
11_I	15_L	1.447	1.00
129_A	139_H	1.436	1.00
109_P	181_Y	1.435	1.00
15_L	19_R	1.434	1.00
105_N	153_Q	1.428	1.00
83_S	141_A	1.406	1.00
83_S	145_K	1.390	1.00
96_V	100_A	1.389	1.00
124_P	147_R	1.389	1.00
32_V	89_A	1.385	1.00
93_N	171_A	1.378	1.00
94_H	155_H	1.374	1.00
84_R	87_A	1.356	1.00
10_I	55_I	1.346	1.00
159_A	171_A	1.309	1.00
79_A	83_S	1.290	1.00
108_I	178_A	1.276	1.00
78_M	82_Q	1.257	1.00
31_S	81_Y	1.254	1.00
64_H	67_G	1.245	1.00
11_I	55_I	1.237	1.00
127_P	142_L	1.233	1.00
31_S	90_V	1.229	1.00
198_E	201_V	1.224	1.00
38_M	60_G	1.223	1.00
101_V	185_L	1.222	1.00
148_K	170_L	1.221	1.00
96_V	176_V	1.192	1.00
138_E	142_L	1.189	1.00
81_Y	90_V	1.188	1.00
16_E	19_R	1.186	1.00
40_I	71_S	1.177	1.00
182_L	187_I	1.175	1.00
33_R	88_N	1.172	1.00
99_T	102_S	1.158	1.00
45_I	54_H	1.151	1.00
181_Y	185_L	1.150	1.00
98_C	157_L	1.143	1.00
57_F	66_E	1.139	1.00
34_Y	57_F	1.125	1.00
13_T	164_L	1.123	1.00
92_H	155_H	1.115	1.00
144_L	160_C	1.114	1.00
139_H	142_L	1.110	1.00
97_H	175_E	1.104	1.00
104_L	187_I	1.096	1.00
17_M	30_V	1.089	1.00
175_E	179_Q	1.083	1.00
42_P	45_I	1.075	1.00
152_L	158_I	1.062	1.00
182_L	186_A	1.059	1.00
93_N	157_L	1.054	1.00
176_V	179_Q	1.050	1.00
17_M	91_V	1.049	1.00
18_T	48_E	1.046	1.00
111_I	181_Y	1.037	1.00
59_D	65_E	1.021	1.00
140_V	152_L	1.014	1.00
127_P	139_H	1.014	1.00
98_C	174_V	1.008	1.00
38_M	74_W	1.000	1.00
114_M	119_G	0.994	1.00
14_C	30_V	0.993	1.00
135_E	138_E	0.991	1.00
149_A	159_A	0.986	1.00
84_R	160_C	0.975	1.00
161_E	170_L	0.959	1.00
197_E	201_V	0.955	1.00
80_A	144_L	0.954	1.00
157_L	171_A	0.948	1.00
20_L	168_L	0.941	1.00
144_L	150_T	0.940	1.00
60_G	82_Q	0.940	1.00
9_Q	12_D	0.925	1.00
95_A	98_C	0.921	1.00
50_L	54_H	0.920	1.00
17_M	168_L	0.916	1.00
96_V	183_T	0.912	1.00
11_I	50_L	0.906	1.00
114_M	117_A	0.899	1.00
13_T	30_V	0.893	1.00
38_M	58_I	0.891	1.00
76_F	140_V	0.887	1.00
185_L	189_D	0.885	1.00
100_A	182_L	0.883	1.00
54_H	68_K	0.872	1.00
126_A	139_H	0.867	1.00
42_P	55_I	0.863	1.00
45_I	69_L	0.862	1.00
5_K	8_R	0.842	1.00
40_I	73_E	0.840	1.00
37_G	57_F	0.839	1.00
6_L	34_Y	0.838	1.00
166_K	170_L	0.837	1.00
9_Q	32_V	0.837	1.00
91_V	171_A	0.833	0.99
95_A	171_A	0.832	0.99
49_K	165_E	0.830	0.99
107_S	125_C	0.829	0.99
76_F	158_I	0.825	0.99
107_S	147_R	0.821	0.99
108_I	151_L	0.820	0.99
118_A	173_E	0.816	0.99
80_A	87_A	0.801	0.99
16_E	168_L	0.796	0.99
14_C	47_Y	0.792	0.99
12_D	49_K	0.785	0.99
79_A	141_A	0.783	0.99
198_E	202_V	0.779	0.99
184_T	191_V	0.779	0.99
108_I	177_L	0.771	0.99
187_I	191_V	0.771	0.99
83_S	142_L	0.766	0.99
95_A	175_E	0.765	0.99
41_T	81_Y	0.761	0.99
142_L	145_K	0.759	0.99
7_A	66_E	0.759	0.99
188_T	191_V	0.749	0.99
31_S	40_I	0.745	0.99
121_N	196_D	0.744	0.99
33_R	60_G	0.741	0.99
45_I	50_L	0.741	0.99
128_Y	152_L	0.736	0.99
37_G	60_G	0.734	0.99
101_V	181_Y	0.730	0.99
21_G	179_Q	0.724	0.99
41_T	50_L	0.715	0.98
105_N	190_P	0.715	0.98
106_R	189_D	0.714	0.98
101_V	178_A	0.712	0.98
29_N	71_S	0.701	0.98
54_H	69_L	0.699	0.98
126_A	129_A	0.699	0.98
88_N	162_V	0.698	0.98
119_G	196_D	0.694	0.98
159_A	170_L	0.694	0.98
107_S	124_P	0.692	0.98
143_A	150_T	0.690	0.98
73_E	136_L	0.687	0.98
74_W	78_M	0.687	0.98
84_R	144_L	0.682	0.98
122_S	147_R	0.682	0.98
126_A	152_L	0.682	0.98
135_E	139_H	0.681	0.98
7_A	39_L	0.677	0.98
75_R	134_R	0.677	0.98
79_A	134_R	0.674	0.98
121_N	200_A	0.674	0.98
89_A	167_A	0.673	0.98
103_I	111_I	0.670	0.98
46_P	49_K	0.669	0.98
166_K	169_W	0.667	0.98
17_M	22_L	0.663	0.97
82_Q	141_A	0.663	0.97
10_I	39_L	0.663	0.97
109_P	122_S	0.663	0.97
126_A	143_A	0.662	0.97
29_N	73_E	0.661	0.97
104_L	189_D	0.656	0.97
174_V	178_A	0.653	0.97
141_A	144_L	0.651	0.97
195_S	201_V	0.648	0.97
28_G	47_Y	0.646	0.97
102_S	151_L	0.645	0.97
26_T	43_T	0.645	0.97
193_V	196_D	0.642	0.97
104_L	184_T	0.642	0.97
25_G	169_W	0.636	0.97
18_T	23_N	0.635	0.97
111_I	185_L	0.633	0.97
49_K	54_H	0.632	0.97
150_T	158_I	0.631	0.97
60_G	78_M	0.630	0.97
123_I	174_V	0.629	0.97
57_F	65_E	0.629	0.97
23_N	30_V	0.629	0.97
95_A	157_L	0.627	0.96
24_Q	176_V	0.623	0.96
97_H	100_A	0.620	0.96
62_G	78_M	0.619	0.96
196_D	199_I	0.618	0.96
6_L	9_Q	0.618	0.96
80_A	158_I	0.617	0.96
114_M	173_E	0.613	0.96
148_K	166_K	0.608	0.96
194_L	199_I	0.607	0.96
99_T	180_L	0.603	0.96
43_T	71_S	0.602	0.96
112_H	115_I	0.599	0.95
33_R	38_M	0.596	0.95
151_L	157_L	0.593	0.95
7_A	52_E	0.592	0.95
6_L	39_L	0.592	0.95
100_A	180_L	0.592	0.95
184_T	190_P	0.592	0.95
24_Q	27_A	0.591	0.95
148_K	162_V	0.588	0.95
12_D	15_L	0.584	0.95
197_E	200_A	0.583	0.95
99_T	156_G	0.583	0.95
98_C	178_A	0.577	0.94
80_A	90_V	0.574	0.94
101_V	182_L	0.574	0.94
16_E	25_G	0.572	0.94
110_A	115_I	0.564	0.94
116_A	119_G	0.563	0.94
10_I	14_C	0.558	0.93
10_I	32_V	0.557	0.93
101_V	106_R	0.557	0.93
105_N	191_V	0.554	0.93
19_R	48_E	0.552	0.93
113_Y	119_G	0.550	0.93
194_L	198_E	0.548	0.93
104_L	182_L	0.547	0.93
134_R	137_S	0.547	0.93
199_I	202_V	0.545	0.93
113_Y	116_A	0.543	0.92
103_I	112_H	0.542	0.92
86_D	162_V	0.541	0.92
139_H	143_A	0.538	0.92
99_T	112_H	0.537	0.92
91_V	159_A	0.536	0.92
81_Y	89_A	0.531	0.92
169_W	176_V	0.531	0.92
27_A	176_V	0.530	0.92
29_N	43_T	0.529	0.91
122_S	125_C	0.528	0.91
141_A	145_K	0.527	0.91
185_L	188_T	0.526	0.91
84_R	148_K	0.525	0.91
7_A	55_I	0.525	0.91
148_K	160_C	0.525	0.91
43_T	72_S	0.524	0.91
58_I	78_M	0.522	0.91
121_N	147_R	0.520	0.91
18_T	24_Q	0.519	0.91
7_A	57_F	0.518	0.91
18_T	47_Y	0.517	0.91
184_T	188_T	0.516	0.90
84_R	145_K	0.515	0.90
75_R	79_A	0.514	0.90
9_Q	164_L	0.512	0.90
41_T	55_I	0.510	0.90
122_S	126_A	0.510	0.90
125_C	153_Q	0.506	0.90
9_Q	163_N	0.505	0.89
30_V	164_L	0.504	0.89
118_A	166_K	0.504	0.89
14_C	41_T	0.501	0.89
107_S	151_L	0.500	0.89

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1e4cP	3	0.9581	100	0.099	Contact Map
4c24A	3	0.9535	100	0.121	Contact Map
3ocrA	4	0.986	100	0.157	Contact Map
2opiA	3	0.9349	100	0.169	Contact Map
1k0wA	3	0.9349	100	0.195	Contact Map
4xxfA	3	0.9442	100	0.2	Contact Map
4m6rA	3	0.9302	100	0.202	Contact Map
2v9lA	3	0.986	100	0.204	Contact Map
2fk5A	4	0.8744	100	0.207	Contact Map
2z7bA	3	0.9767	100	0.212	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.