ACYP - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ACYP - Acylphosphatase

UniProt:	P0AB65	Sequences: MSKVCIIAWVYGRVQGVGFRYTTQYEAKRLGLTGYAKNLDDGSVEVVACGEEGQVEKLMQWLKSGGPRSARVERVLSEPHHPSGELTDFRIR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13726
Length:	92 (84)
Sequences:	2151 (1649)
Seq/√Len:	179.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_T	61_W	3.015	1.00
26_E	29_R	2.834	1.00
48_A	58_L	2.779	1.00
9_W	43_S	2.717	1.00
18_G	21_Y	2.520	1.00
11_Y	43_S	2.423	1.00
11_Y	74_R	2.299	1.00
39_L	45_E	2.160	1.00
5_C	49_C	2.015	1.00
8_A	59_M	1.722	1.00
8_A	62_L	1.717	1.00
7_I	45_E	1.637	1.00
24_Q	28_K	1.636	1.00
49_C	85_E	1.630	1.00
5_C	47_V	1.551	1.00
39_L	43_S	1.548	1.00
67_P	70_A	1.536	1.00
46_V	62_L	1.526	1.00
8_A	48_A	1.436	1.00
8_A	46_V	1.408	1.00
6_I	79_P	1.384	1.00
23_T	58_L	1.370	1.00
52_E	56_E	1.357	1.00
59_M	77_S	1.328	1.00
33_T	88_D	1.312	1.00
8_A	77_S	1.272	1.00
66_G	70_A	1.242	1.00
5_C	86_L	1.229	1.00
49_C	84_G	1.212	1.00
48_A	62_L	1.206	1.00
23_T	62_L	1.205	1.00
37_K	45_E	1.177	1.00
7_I	35_Y	1.154	1.00
21_Y	25_Y	1.140	1.00
21_Y	24_Q	1.136	1.00
11_Y	76_L	1.115	1.00
7_I	80_H	1.101	1.00
54_Q	57_K	1.070	1.00
51_E	54_Q	1.055	1.00
30_L	58_L	1.050	1.00
36_A	46_V	1.041	1.00
56_E	60_Q	1.038	1.00
26_E	61_W	1.037	1.00
48_A	55_V	1.030	1.00
47_V	80_H	0.981	0.99
30_L	61_W	0.978	0.99
30_L	57_K	0.977	0.99
26_E	30_L	0.971	0.99
6_I	55_V	0.959	0.99
10_V	62_L	0.957	0.99
63_K	75_V	0.954	0.99
18_G	22_T	0.952	0.99
18_G	69_S	0.945	0.99
32_L	50_G	0.930	0.99
52_E	79_P	0.912	0.99
59_M	63_K	0.903	0.99
23_T	48_A	0.870	0.98
23_T	61_W	0.860	0.98
60_Q	63_K	0.858	0.98
10_V	46_V	0.857	0.98
35_Y	47_V	0.846	0.98
6_I	59_M	0.824	0.98
25_Y	28_K	0.821	0.98
19_F	62_L	0.811	0.97
6_I	77_S	0.807	0.97
35_Y	45_E	0.800	0.97
35_Y	46_V	0.796	0.97
49_C	82_P	0.783	0.97
47_V	86_L	0.781	0.97
46_V	58_L	0.766	0.96
9_W	39_L	0.757	0.96
13_R	71_R	0.751	0.96
18_G	25_Y	0.747	0.96
82_P	86_L	0.741	0.95
49_C	86_L	0.737	0.95
18_G	68_R	0.734	0.95
57_K	60_Q	0.725	0.95
9_W	76_L	0.717	0.95
30_L	54_Q	0.712	0.94
22_T	26_E	0.708	0.94
7_I	78_E	0.703	0.94
5_C	80_H	0.696	0.94
82_P	85_E	0.692	0.94
6_I	48_A	0.689	0.93
33_T	49_C	0.682	0.93
10_V	75_V	0.680	0.93
9_W	45_E	0.674	0.93
86_L	90_R	0.673	0.93
32_L	48_A	0.661	0.92
23_T	36_A	0.658	0.92
47_V	85_E	0.651	0.91
31_G	54_Q	0.640	0.91
63_K	77_S	0.638	0.90
64_S	67_P	0.633	0.90
8_A	75_V	0.633	0.90
56_E	79_P	0.628	0.90
22_T	70_A	0.622	0.89
33_T	86_L	0.615	0.89
87_T	90_R	0.608	0.88
55_V	59_M	0.605	0.88
5_C	85_E	0.604	0.88
50_G	54_Q	0.603	0.88
28_K	81_H	0.593	0.87
52_E	87_T	0.590	0.87
57_K	61_W	0.585	0.86
28_K	88_D	0.580	0.86
54_Q	58_L	0.572	0.85
35_Y	39_L	0.572	0.85
51_E	87_T	0.568	0.85
7_I	36_A	0.568	0.85
56_E	77_S	0.563	0.84
24_Q	36_A	0.557	0.84
13_R	18_G	0.554	0.83
5_C	84_G	0.549	0.83
10_V	67_P	0.541	0.82
72_V	75_V	0.538	0.81
33_T	84_G	0.536	0.81
7_I	47_V	0.535	0.81
14_V	44_V	0.533	0.81
19_F	23_T	0.525	0.80
32_L	51_E	0.524	0.80
64_S	68_R	0.515	0.79
22_T	67_P	0.512	0.78
81_H	84_G	0.502	0.77
35_Y	66_G	0.502	0.77
73_E	90_R	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4hi1A	3	0.9565	100	0.159	Contact Map
2gv1A	1	0.9891	100	0.164	Contact Map
4g9iA	1	0.9674	100	0.172	Contact Map
3trgA	1	0.9783	100	0.174	Contact Map
1w2iA	2	0.9674	100	0.177	Contact Map
2bjdA	1	0.9783	100	0.177	Contact Map
2lxfA	1	0.9783	100	0.182	Contact Map
2fhmA	1	0.9674	100	0.186	Contact Map
1ulrA	1	0.9457	100	0.193	Contact Map
1urrA	1	1	100	0.202	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.