MCBA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MCBA - Uncharacterized protein McbA

UniProt:	P0AAX6	Sequences: MKKCLTLLIATVLSGISLTAYAAQPMSNLDSGQLRPAGTVSATGASNLSDLEDKLAEKAREQGAKGYVINSAGGNDQMFGTATIYK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13318
Length:	86 (86)
Sequences:	466 (251)
Seq/√Len:	27.0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
70_N	83_T	3.320	1.00
68_V	83_T	2.624	0.99
56_A	60_R	2.607	0.99
21_Y	25_P	2.382	0.99
48_L	80_G	2.209	0.98
55_L	82_A	2.160	0.97
74_G	78_M	2.154	0.97
39_T	70_N	2.005	0.96
42_A	55_L	1.739	0.91
76_D	84_I	1.737	0.91
47_N	50_D	1.707	0.91
6_T	10_A	1.659	0.89
51_L	78_M	1.656	0.89
19_T	62_Q	1.597	0.88
57_E	60_R	1.522	0.85
16_I	19_T	1.508	0.84
57_E	61_E	1.483	0.83
70_N	81_T	1.480	0.83
36_P	83_T	1.477	0.83
27_S	66_G	1.476	0.83
5_L	13_L	1.475	0.83
38_G	55_L	1.450	0.82
25_P	67_Y	1.422	0.81
51_L	74_G	1.406	0.80
24_Q	37_A	1.381	0.79
42_A	51_L	1.318	0.75
37_A	45_A	1.312	0.75
7_L	43_T	1.304	0.74
30_D	76_D	1.285	0.73
65_K	86_K	1.226	0.70
45_A	51_L	1.224	0.69
73_G	79_F	1.203	0.68
16_I	21_Y	1.202	0.68
38_G	41_S	1.202	0.68
26_M	34_L	1.200	0.68
65_K	68_V	1.193	0.67
24_Q	27_S	1.182	0.67
44_G	77_Q	1.149	0.64
55_L	84_I	1.122	0.63
14_S	18_L	1.085	0.60
41_S	81_T	1.034	0.56
46_S	51_L	1.033	0.56
35_R	68_V	1.031	0.56
11_T	62_Q	0.986	0.53
16_I	86_K	0.978	0.52
51_L	76_D	0.951	0.50
4_C	36_P	0.946	0.50
40_V	45_A	0.941	0.49
11_T	36_P	0.920	0.48
38_G	80_G	0.914	0.47
16_I	79_F	0.909	0.47
50_D	53_D	0.909	0.47
36_P	39_T	0.906	0.47
11_T	58_K	0.899	0.46
26_M	68_V	0.899	0.46
22_A	69_I	0.891	0.45
7_L	30_D	0.891	0.45
48_L	51_L	0.887	0.45
38_G	48_L	0.885	0.45
6_T	39_T	0.884	0.45
56_A	84_I	0.879	0.45
16_I	43_T	0.875	0.44
56_A	83_T	0.868	0.44
30_D	47_N	0.864	0.43
48_L	72_A	0.861	0.43
43_T	78_M	0.858	0.43
30_D	66_G	0.856	0.43
42_A	82_A	0.846	0.42
37_A	44_G	0.843	0.42
52_E	57_E	0.842	0.42
42_A	80_G	0.832	0.41
7_L	41_S	0.822	0.40
71_S	81_T	0.821	0.40
38_G	84_I	0.813	0.40
6_T	11_T	0.805	0.39
13_L	44_G	0.792	0.38
43_T	46_S	0.786	0.38
71_S	79_F	0.784	0.38
49_S	84_I	0.782	0.38
67_Y	71_S	0.775	0.37
7_L	20_A	0.771	0.37
50_D	61_E	0.768	0.37
69_I	83_T	0.752	0.35
14_S	85_Y	0.743	0.35
4_C	20_A	0.730	0.34
25_P	28_N	0.727	0.34
40_V	60_R	0.720	0.33
10_A	33_Q	0.692	0.31
11_T	54_K	0.685	0.31
36_P	84_I	0.674	0.30
75_N	78_M	0.674	0.30
57_E	66_G	0.671	0.30
12_V	29_L	0.666	0.30
21_Y	32_G	0.658	0.29
41_S	85_Y	0.657	0.29
51_L	80_G	0.642	0.28
55_L	83_T	0.637	0.28
14_S	19_T	0.637	0.28
3_K	50_D	0.633	0.28
4_C	8_L	0.626	0.27
45_A	75_N	0.625	0.27
29_L	40_V	0.619	0.27
54_K	57_E	0.610	0.26
12_V	15_G	0.588	0.25
52_E	69_I	0.588	0.25
18_L	31_S	0.588	0.25
56_A	67_Y	0.586	0.25
13_L	20_A	0.582	0.25
42_A	46_S	0.574	0.24
16_I	81_T	0.573	0.24
30_D	34_L	0.573	0.24
14_S	35_R	0.571	0.24
1_M	81_T	0.566	0.24
16_I	77_Q	0.557	0.23
40_V	77_Q	0.556	0.23
15_G	33_Q	0.553	0.23
48_L	74_G	0.551	0.23
36_P	50_D	0.546	0.23
49_S	79_F	0.540	0.22
25_P	35_R	0.534	0.22
13_L	18_L	0.523	0.22
45_A	61_E	0.523	0.22
29_L	32_G	0.522	0.22
9_I	15_G	0.515	0.21
42_A	71_S	0.514	0.21
77_Q	84_I	0.511	0.21
76_D	86_K	0.508	0.21
47_N	77_Q	0.506	0.21
45_A	80_G	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2nocA	1	0.9884	100	0.143	Contact Map
2jnaA	2	0.9884	100	0.163	Contact Map
2m2jA	1	0.7674	99.9	0.32	Contact Map
2ma4A	1	0.7442	99.8	0.34	Contact Map
4evuA	2	0.7558	99.8	0.391	Contact Map
4n4rB	1	0.6977	41.6	0.889	Contact Map
3layA	5	0.686	40.7	0.89	Contact Map
3b55A	1	0.5581	38.2	0.892	Contact Map
2qgmA	1	0.5698	24.4	0.902	Contact Map
4ivkA	4	0.6512	22	0.904	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.