YBAK - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YBAK - Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK

UniProt:	P0AAR3	Sequences: MTPAVKLLEKNKISFQIHTYEHDPAETNFGDEVVKKLGLNPDQVYKTLLVAVNGDMKHLAVAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGISPLGQKKRLPTIIDAPAQEFATIYVSGGKRGLDIELAAGDLAKILDAKFADIARRD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12454
Length:	159 (148)
Sequences:	4377 (2957)
Seq/√Len:	243.0

ECOLI - YBAK YEAK
BACSU - YJDI YWHH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
125_T	138_E	3.143	1.00
58_H	113_P	2.551	1.00
9_E	15_F	2.549	1.00
51_A	91_V	2.506	1.00
79_L	115_I	2.497	1.00
143_D	146_K	2.481	1.00
30_G	66_V	2.403	1.00
92_A	103_I	2.290	1.00
145_A	152_F	2.269	1.00
52_V	81_A	2.264	1.00
74_K	154_D	2.195	1.00
121_Q	152_F	2.150	1.00
31_D	35_K	2.115	1.00
140_A	143_D	2.081	1.00
78_A	153_A	2.073	1.00
118_A	154_D	2.011	1.00
62_A	75_V	1.891	1.00
88_D	91_V	1.859	1.00
16_Q	138_E	1.859	1.00
59_L	95_S	1.795	1.00
111_R	149_D	1.749	1.00
7_L	11_N	1.735	1.00
127_Y	138_E	1.703	1.00
11_N	147_I	1.695	1.00
18_H	138_E	1.693	1.00
43_Q	123_F	1.684	1.00
42_D	123_F	1.605	1.00
50_V	75_V	1.601	1.00
40_N	43_Q	1.551	1.00
56_M	81_A	1.515	1.00
50_V	70_L	1.504	1.00
108_Q	114_T	1.466	1.00
45_Y	63_V	1.463	1.00
60_A	75_V	1.444	1.00
89_P	100_V	1.434	1.00
145_A	150_A	1.384	1.00
118_A	122_E	1.382	1.00
42_D	67_A	1.380	1.00
78_A	151_K	1.379	1.00
6_K	10_K	1.345	1.00
6_K	9_E	1.329	1.00
49_L	112_L	1.301	1.00
93_Q	99_L	1.281	1.00
115_I	155_I	1.273	1.00
68_G	156_A	1.254	1.00
39_L	127_Y	1.226	1.00
71_D	74_K	1.225	1.00
18_H	127_Y	1.221	1.00
59_L	112_L	1.207	1.00
142_G	145_A	1.202	1.00
121_Q	142_G	1.199	1.00
52_V	58_H	1.199	1.00
52_V	56_M	1.197	1.00
17_I	135_L	1.193	1.00
61_V	108_Q	1.185	1.00
73_K	77_K	1.180	1.00
116_I	145_A	1.180	1.00
5_V	9_E	1.179	1.00
5_V	17_I	1.171	1.00
62_A	155_I	1.161	1.00
45_Y	120_A	1.160	1.00
43_Q	138_E	1.159	1.00
60_A	79_L	1.153	1.00
16_Q	125_T	1.141	1.00
32_E	36_K	1.131	1.00
52_V	84_V	1.127	1.00
120_A	152_F	1.126	1.00
13_I	147_I	1.122	1.00
32_E	35_K	1.120	1.00
43_Q	125_T	1.092	1.00
51_A	85_E	1.087	1.00
118_A	121_Q	1.069	1.00
8_L	137_I	1.066	1.00
59_L	87_A	1.066	1.00
87_A	95_S	1.064	1.00
119_P	122_E	1.051	1.00
48_L	70_L	1.046	1.00
50_V	60_A	1.043	1.00
91_V	95_S	1.036	1.00
115_I	153_A	1.020	1.00
23_D	28_N	1.009	1.00
35_K	41_P	1.008	1.00
48_L	86_M	1.007	1.00
51_A	59_L	0.991	1.00
23_D	32_E	0.990	1.00
113_P	151_K	0.988	1.00
81_A	84_V	0.987	1.00
74_K	77_K	0.970	1.00
128_V	139_L	0.952	1.00
20_Y	24_P	0.950	1.00
31_D	41_P	0.939	1.00
51_A	57_K	0.926	1.00
3_P	109_K	0.924	1.00
68_G	119_P	0.923	1.00
28_N	32_E	0.921	1.00
60_A	81_A	0.919	1.00
29_F	32_E	0.911	1.00
91_V	94_R	0.906	1.00
120_A	126_I	0.900	1.00
116_I	120_A	0.899	1.00
95_S	112_L	0.881	0.99
93_Q	100_V	0.880	0.99
99_L	133_R	0.877	0.99
132_K	135_L	0.876	0.99
49_L	92_A	0.870	0.99
142_G	146_K	0.870	0.99
20_Y	23_D	0.869	0.99
130_G	136_D	0.866	0.99
92_A	100_V	0.850	0.99
52_V	60_A	0.847	0.99
11_N	146_K	0.840	0.99
39_L	44_V	0.836	0.99
115_I	151_K	0.831	0.99
37_L	127_Y	0.831	0.99
117_D	154_D	0.831	0.99
123_F	126_I	0.817	0.99
20_Y	37_L	0.812	0.99
117_D	156_A	0.812	0.99
130_G	137_I	0.811	0.99
139_L	143_D	0.804	0.99
64_T	155_I	0.796	0.99
121_Q	145_A	0.786	0.99
35_K	38_G	0.784	0.99
30_G	41_P	0.776	0.99
45_Y	119_P	0.769	0.99
33_V	136_D	0.765	0.99
44_V	136_D	0.764	0.99
121_Q	141_A	0.759	0.98
14_S	143_D	0.755	0.98
105_P	144_L	0.754	0.98
116_I	150_A	0.753	0.98
19_T	135_L	0.752	0.98
41_P	67_A	0.746	0.98
124_A	140_A	0.745	0.98
21_E	36_K	0.745	0.98
20_Y	134_G	0.742	0.98
7_L	10_K	0.734	0.98
60_A	84_V	0.730	0.98
47_T	61_V	0.729	0.98
73_K	82_K	0.726	0.98
116_I	152_F	0.723	0.98
106_L	148_L	0.715	0.98
58_H	81_A	0.715	0.98
128_V	144_L	0.712	0.98
89_P	92_A	0.702	0.97
75_V	84_V	0.699	0.97
106_L	144_L	0.697	0.97
90_M	93_Q	0.696	0.97
8_L	15_F	0.694	0.97
22_H	32_E	0.692	0.97
37_L	136_D	0.691	0.97
116_I	144_L	0.691	0.97
45_Y	126_I	0.686	0.97
52_V	79_L	0.682	0.97
45_Y	123_F	0.679	0.97
85_E	88_D	0.677	0.97
51_A	56_M	0.675	0.97
129_S	136_D	0.674	0.97
97_G	109_K	0.673	0.97
13_I	143_D	0.671	0.97
3_P	6_K	0.662	0.96
74_K	78_A	0.658	0.96
50_V	62_A	0.649	0.96
9_E	14_S	0.648	0.96
49_L	87_A	0.647	0.96
5_V	15_F	0.639	0.96
24_P	32_E	0.637	0.96
89_P	93_Q	0.637	0.96
63_V	116_I	0.637	0.96
142_G	152_F	0.628	0.95
62_A	79_L	0.622	0.95
141_A	152_F	0.617	0.95
13_I	16_Q	0.616	0.95
21_E	24_P	0.615	0.95
76_A	82_K	0.614	0.95
95_S	110_K	0.606	0.94
8_L	13_I	0.606	0.94
8_L	147_I	0.603	0.94
4_A	147_I	0.600	0.94
31_D	67_A	0.597	0.94
96_T	109_K	0.593	0.94
50_V	84_V	0.589	0.93
39_L	138_E	0.587	0.93
64_T	70_L	0.587	0.93
127_Y	136_D	0.581	0.93
48_L	64_T	0.580	0.93
23_D	36_K	0.578	0.93
7_L	147_I	0.576	0.93
30_G	34_V	0.575	0.93
122_E	154_D	0.571	0.92
62_A	115_I	0.570	0.92
43_Q	124_A	0.569	0.92
67_A	122_E	0.558	0.91
15_F	143_D	0.554	0.91
4_A	137_I	0.543	0.90
43_Q	127_Y	0.540	0.90
50_V	86_M	0.539	0.90
41_P	66_V	0.537	0.90
62_A	70_L	0.536	0.90
45_Y	64_T	0.536	0.90
45_Y	117_D	0.534	0.89
46_K	98_Y	0.533	0.89
29_F	33_V	0.532	0.89
108_Q	112_L	0.529	0.89
61_V	112_L	0.528	0.89
49_L	103_I	0.526	0.89
14_S	140_A	0.523	0.89
40_N	123_F	0.520	0.88
49_L	96_T	0.519	0.88
33_V	137_I	0.519	0.88
107_G	112_L	0.518	0.88
70_L	155_I	0.515	0.88
51_A	87_A	0.511	0.87
64_T	156_A	0.510	0.87
33_V	39_L	0.508	0.87
39_L	43_Q	0.507	0.87
57_K	81_A	0.506	0.87
10_K	110_K	0.504	0.87
49_L	61_V	0.503	0.87
20_Y	136_D	0.503	0.87
65_P	68_G	0.502	0.86
18_H	125_T	0.500	0.86

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1dbuA	1	0.956	100	0.181	Contact Map
2dxaA	1	0.9937	100	0.198	Contact Map
2z0xA	1	0.9497	100	0.211	Contact Map
3op6A	2	0.9308	100	0.222	Contact Map
1vjfA	1	0.9623	100	0.222	Contact Map
1wdvA	1	0.9371	100	0.224	Contact Map
1vkiA	2	0.9497	100	0.236	Contact Map
3memA	1	0.8616	100	0.368	Contact Map
2j3lA	2	0.9811	98.3	0.786	Contact Map
1z3eA	1	0.4906	56.1	0.914	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.