ISCA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ISCA - Iron-binding protein IscA

UniProt:	P0AAC8	Sequences: MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12132
Length:	107 (104)
Sequences:	3515 (1834)
Seq/√Len:	179.8

ECOLI - ISCA SUFA ERPA
BACSU - SUFA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
76_Q	91_T	4.525	1.00
12_R	15_T	3.502	1.00
65_D	68_S	3.116	1.00
10_A	58_K	3.109	1.00
25_G	63_V	3.058	1.00
29_G	41_V	2.818	1.00
4_T	76_Q	2.693	1.00
95_V	98_E	2.587	1.00
56_E	61_K	2.545	1.00
7_D	58_K	2.457	1.00
54_V	61_K	2.414	1.00
22_K	46_D	2.123	1.00
31_R	41_V	2.101	1.00
27_R	52_D	2.005	1.00
3_I	77_L	1.974	1.00
6_S	78_D	1.931	1.00
48_P	63_V	1.861	1.00
75_T	90_F	1.860	1.00
56_E	59_G	1.806	1.00
14_N	59_G	1.734	1.00
81_K	86_E	1.720	1.00
14_N	18_A	1.568	1.00
25_G	61_K	1.558	1.00
38_M	71_F	1.543	1.00
48_P	54_V	1.460	1.00
7_D	57_D	1.406	1.00
80_V	89_K	1.327	1.00
8_S	78_D	1.307	1.00
33_S	83_G	1.263	1.00
45_V	48_P	1.237	1.00
11_A	14_N	1.231	1.00
97_D	106_H	1.220	1.00
5_L	13_V	1.216	1.00
13_V	26_L	1.208	1.00
53_I	66_G	1.199	1.00
7_D	11_A	1.198	1.00
45_V	49_T	1.184	1.00
70_Q	73_D	1.147	1.00
20_R	24_F	1.139	1.00
28_L	72_L	1.104	1.00
12_R	88_F	1.056	1.00
82_E	89_K	1.055	1.00
36_S	106_H	1.053	1.00
67_K	70_Q	1.040	1.00
8_S	11_A	0.995	0.99
75_T	103_E	0.985	0.99
12_R	16_F	0.974	0.99
80_V	85_N	0.949	0.99
10_A	60_V	0.946	0.99
66_G	70_Q	0.933	0.99
17_L	23_G	0.926	0.99
55_F	69_L	0.920	0.99
32_T	36_S	0.913	0.99
49_T	52_D	0.913	0.99
10_A	57_D	0.900	0.99
5_L	62_V	0.881	0.98
9_A	100_G	0.853	0.98
33_S	39_A	0.845	0.98
24_F	48_P	0.824	0.98
26_L	88_F	0.820	0.98
11_A	58_K	0.818	0.97
53_I	69_L	0.811	0.97
18_A	21_G	0.810	0.97
74_G	93_P	0.810	0.97
82_E	87_G	0.800	0.97
20_R	46_D	0.799	0.97
33_S	95_V	0.788	0.97
12_R	84_L	0.785	0.97
5_L	57_D	0.781	0.97
48_P	61_K	0.774	0.96
68_S	77_L	0.773	0.96
25_G	48_P	0.770	0.96
96_K	106_H	0.769	0.96
5_L	88_F	0.769	0.96
17_L	24_F	0.768	0.96
12_R	79_F	0.763	0.96
72_L	94_N	0.740	0.95
30_V	105_F	0.738	0.95
14_N	58_K	0.729	0.95
82_E	86_E	0.728	0.95
29_G	43_E	0.724	0.95
82_E	85_N	0.719	0.95
7_D	10_A	0.718	0.95
36_S	105_F	0.712	0.94
42_L	71_F	0.705	0.94
80_V	87_G	0.704	0.94
38_M	105_F	0.701	0.94
17_L	25_G	0.697	0.94
69_L	73_D	0.694	0.94
28_L	77_L	0.692	0.94
14_N	60_V	0.690	0.93
5_L	10_A	0.688	0.93
74_G	94_N	0.685	0.93
13_V	60_V	0.684	0.93
27_R	45_V	0.683	0.93
11_A	18_A	0.673	0.93
53_I	73_D	0.672	0.93
17_L	44_F	0.658	0.92
9_A	85_N	0.658	0.92
38_M	42_L	0.650	0.91
101_C	104_S	0.648	0.91
12_R	81_K	0.644	0.91
10_A	59_G	0.641	0.91
24_F	46_D	0.634	0.90
36_S	97_D	0.629	0.90
13_V	88_F	0.629	0.90
9_A	96_K	0.626	0.90
95_V	105_F	0.623	0.89
80_V	84_L	0.619	0.89
15_T	18_A	0.617	0.89
32_T	38_M	0.606	0.88
14_N	17_L	0.604	0.88
42_L	85_N	0.602	0.88
30_V	33_S	0.598	0.87
36_S	71_F	0.597	0.87
3_I	75_T	0.595	0.87
5_L	77_L	0.595	0.87
102_G	105_F	0.588	0.87
92_N	95_V	0.582	0.86
16_F	88_F	0.579	0.86
32_T	67_K	0.570	0.85
57_D	62_V	0.564	0.84
17_L	22_K	0.559	0.84
23_G	44_F	0.559	0.84
54_V	63_V	0.558	0.84
21_G	46_D	0.557	0.84
38_M	100_G	0.556	0.83
79_F	86_E	0.555	0.83
53_I	70_Q	0.555	0.83
4_T	74_G	0.552	0.83
13_V	17_L	0.549	0.83
67_K	71_F	0.546	0.82
16_F	44_F	0.544	0.82
81_K	100_G	0.544	0.82
69_L	89_K	0.542	0.82
32_T	42_L	0.540	0.82
101_C	105_F	0.536	0.81
18_A	22_K	0.533	0.81
33_S	36_S	0.528	0.80
42_L	75_T	0.526	0.80
68_S	72_L	0.523	0.80
32_T	106_H	0.523	0.80
98_E	103_E	0.523	0.80
38_M	86_E	0.523	0.80
25_G	62_V	0.521	0.79
45_V	52_D	0.520	0.79
18_A	49_T	0.519	0.79
33_S	98_E	0.518	0.79
10_A	14_N	0.512	0.78
38_M	66_G	0.508	0.78
36_S	86_E	0.504	0.77
22_K	47_E	0.503	0.77
12_R	38_M	0.503	0.77
3_I	74_G	0.503	0.77
40_Y	102_G	0.502	0.77
90_F	103_E	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2d2aA	2	1	100	0.114	Contact Map
1r94A	3	0.9065	100	0.134	Contact Map
1nwbA	1	0.8692	100	0.145	Contact Map
1x0gA	4	0.9907	100	0.156	Contact Map
2apnA	1	1	100	0.156	Contact Map
2k4zA	1	0.9252	100	0.318	Contact Map
2p2eA	1	0.9626	99.9	0.434	Contact Map
2qgoA	1	0.8411	99.9	0.46	Contact Map
2oxgY	1	0.3271	15	0.93	Contact Map
3butA	2	0.3458	11.9	0.933	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.