WZB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

WZB - Low molecular weight protein-tyrosine-phosphatase wzb

UniProt:	P0AAB2	Sequences: MFNNILVVCVGNICRSPTAERLLQRYHPELKVESAGLGALVGKGADPTAISVAAEHQLSLEGHCARQISRRLCRNYDLILTMEKRHIERLCEMAPEMRGKVMLFGHWDNECEIPDPYRKSRETFAAVYTLLERSARQWAQALNAEQV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13567
Length:	147 (139)
Sequences:	4681 (3568)
Seq/√Len:	302.7

ECOLI - WZB ETP
BACSU - PAP YFKJ ARSC
HALSA - ARSC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_Y	136_R	3.421	1.00
20_E	24_Q	3.039	1.00
68_I	90_L	2.835	1.00
81_T	90_L	2.449	1.00
114_P	130_L	2.395	1.00
4_N	31_K	2.366	1.00
53_A	60_L	2.139	1.00
18_T	49_A	2.122	1.00
84_K	112_E	2.111	1.00
10_V	86_H	2.103	1.00
55_E	125_A	1.876	1.00
119_K	123_T	1.825	1.00
7_V	23_L	1.787	1.00
6_L	35_A	1.774	1.00
33_E	66_R	1.761	1.00
52_V	125_A	1.731	1.00
87_I	91_C	1.653	1.00
18_T	53_A	1.642	1.00
102_M	107_W	1.634	1.00
104_F	135_A	1.576	1.00
5_I	23_L	1.573	1.00
104_F	131_L	1.563	1.00
56_H	132_E	1.540	1.00
26_Y	132_E	1.534	1.00
71_R	75_N	1.517	1.00
81_T	87_I	1.501	1.00
56_H	128_Y	1.486	1.00
31_K	75_N	1.468	1.00
52_V	55_E	1.465	1.00
27_H	30_L	1.459	1.00
33_E	76_Y	1.448	1.00
22_L	128_Y	1.405	1.00
27_H	32_V	1.397	1.00
41_V	65_A	1.397	1.00
10_V	38_G	1.388	1.00
52_V	128_Y	1.377	1.00
66_R	72_L	1.376	1.00
37_L	89_R	1.368	1.00
26_Y	135_A	1.366	1.00
56_H	129_T	1.351	1.00
45_A	63_H	1.349	1.00
23_L	32_V	1.346	1.00
41_V	67_Q	1.332	1.00
22_L	135_A	1.326	1.00
22_L	131_L	1.326	1.00
84_K	103_L	1.319	1.00
126_A	130_L	1.315	1.00
44_G	50_I	1.307	1.00
51_S	121_R	1.304	1.00
45_A	50_I	1.293	1.00
102_M	106_H	1.275	1.00
105_G	130_L	1.220	1.00
21_R	58_L	1.217	1.00
21_R	60_L	1.216	1.00
58_L	132_E	1.209	1.00
50_I	60_L	1.192	1.00
45_A	60_L	1.166	1.00
87_I	101_V	1.140	1.00
103_L	112_E	1.136	1.00
107_W	138_W	1.112	1.00
91_C	101_V	1.112	1.00
50_I	54_A	1.092	1.00
52_V	56_H	1.091	1.00
35_A	66_R	1.091	1.00
19_A	82_M	1.088	1.00
24_Q	32_V	1.087	1.00
120_S	123_T	1.078	1.00
39_A	67_Q	1.074	1.00
73_C	97_M	1.069	1.00
73_C	79_I	1.062	1.00
51_S	55_E	1.057	1.00
132_E	136_R	1.053	1.00
81_T	103_L	1.036	1.00
107_W	141_A	1.030	1.00
4_N	75_N	1.030	1.00
137_Q	140_Q	1.015	1.00
23_L	135_A	1.008	1.00
74_R	96_E	1.002	1.00
105_G	134_S	1.001	1.00
49_A	52_V	1.001	1.00
70_R	93_M	0.994	1.00
89_R	92_E	0.989	1.00
85_R	89_R	0.974	1.00
78_L	102_M	0.973	1.00
121_R	125_A	0.971	1.00
78_L	138_W	0.961	1.00
21_R	24_Q	0.953	1.00
90_L	101_V	0.949	1.00
106_H	110_E	0.945	1.00
127_V	131_L	0.944	1.00
82_M	104_F	0.937	1.00
87_I	103_L	0.935	1.00
83_E	86_H	0.933	1.00
125_A	129_T	0.930	1.00
18_T	128_Y	0.927	1.00
80_L	138_W	0.924	1.00
55_E	121_R	0.924	1.00
47_P	51_S	0.914	1.00
89_R	93_M	0.906	1.00
38_G	41_V	0.902	1.00
68_I	73_C	0.901	1.00
7_V	19_A	0.897	1.00
82_M	113_I	0.886	1.00
10_V	85_R	0.885	1.00
80_L	102_M	0.875	1.00
6_L	76_Y	0.874	1.00
21_R	63_H	0.868	1.00
46_D	124_F	0.867	1.00
97_M	100_K	0.863	1.00
26_Y	139_A	0.863	1.00
37_L	90_L	0.858	1.00
104_F	134_S	0.850	1.00
21_R	45_A	0.842	1.00
71_R	74_R	0.838	1.00
58_L	128_Y	0.822	1.00
80_L	107_W	0.813	1.00
27_H	139_A	0.808	1.00
22_L	58_L	0.807	1.00
94_A	101_V	0.806	1.00
91_C	94_A	0.805	1.00
107_W	137_Q	0.803	1.00
35_A	68_I	0.799	1.00
8_V	90_L	0.796	1.00
8_V	79_I	0.791	1.00
48_T	121_R	0.788	0.99
54_A	60_L	0.781	0.99
40_L	43_K	0.778	0.99
73_C	94_A	0.758	0.99
52_V	121_R	0.755	0.99
138_W	142_L	0.755	0.99
45_A	53_A	0.753	0.99
110_E	126_A	0.750	0.99
102_M	141_A	0.749	0.99
94_A	97_M	0.748	0.99
4_N	76_Y	0.739	0.99
18_T	52_V	0.736	0.99
44_G	64_C	0.733	0.99
128_Y	132_E	0.728	0.99
12_N	16_S	0.704	0.99
74_R	97_M	0.703	0.99
10_V	83_E	0.698	0.99
79_I	90_L	0.693	0.99
103_L	106_H	0.685	0.99
19_A	104_F	0.683	0.99
72_L	76_Y	0.682	0.99
23_L	26_Y	0.682	0.99
69_S	72_L	0.677	0.98
73_C	90_L	0.677	0.98
123_T	126_A	0.675	0.98
70_R	74_R	0.673	0.98
80_L	104_F	0.665	0.98
6_L	66_R	0.650	0.98
48_T	119_K	0.635	0.98
78_L	142_L	0.635	0.98
6_L	79_I	0.632	0.98
50_I	61_E	0.632	0.98
39_A	43_K	0.629	0.98
19_A	131_L	0.626	0.97
56_H	125_A	0.624	0.97
4_N	33_E	0.620	0.97
44_G	63_H	0.618	0.97
108_D	111_C	0.618	0.97
94_A	99_G	0.615	0.97
73_C	95_P	0.606	0.97
82_M	86_H	0.603	0.97
35_A	72_L	0.601	0.97
49_A	53_A	0.596	0.97
18_T	127_V	0.584	0.96
21_R	59_S	0.583	0.96
118_R	123_T	0.583	0.96
105_G	112_E	0.580	0.96
33_E	75_N	0.577	0.96
78_L	107_W	0.569	0.96
127_V	130_L	0.568	0.96
113_I	130_L	0.568	0.96
69_S	75_N	0.565	0.95
53_A	58_L	0.564	0.95
38_G	89_R	0.563	0.95
94_A	100_K	0.558	0.95
113_I	134_S	0.555	0.95
48_T	120_S	0.554	0.95
104_F	138_W	0.551	0.95
54_A	59_S	0.549	0.95
22_L	132_E	0.548	0.95
38_G	67_Q	0.542	0.94
9_C	12_N	0.539	0.94
43_K	65_A	0.537	0.94
60_L	63_H	0.536	0.94
46_D	117_Y	0.533	0.94
23_L	138_W	0.531	0.94
131_L	135_A	0.530	0.94
36_G	39_A	0.529	0.94
10_V	89_R	0.528	0.93
21_R	62_G	0.528	0.93
108_D	133_R	0.524	0.93
66_R	76_Y	0.523	0.93
84_K	110_E	0.522	0.93
22_L	26_Y	0.521	0.93
13_I	124_F	0.516	0.93
118_R	124_F	0.515	0.93
138_W	141_A	0.511	0.92
5_I	78_L	0.508	0.92
13_I	46_D	0.507	0.92
6_L	68_I	0.506	0.92
122_E	125_A	0.504	0.92
106_H	111_C	0.503	0.92
46_D	118_R	0.500	0.92
123_T	127_V	0.500	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fekA	1	0.9932	100	0.13	Contact Map
2wmyA	3	0.9796	100	0.144	Contact Map
2wjaA	1	0.9524	100	0.144	Contact Map
4picA	2	0.9864	100	0.145	Contact Map
4lrqA	2	0.966	100	0.164	Contact Map
4etnA	1	0.9524	100	0.168	Contact Map
2gi4A	1	0.9796	100	0.168	Contact Map
4egsA	2	0.9524	100	0.168	Contact Map
3jviA	1	0.9728	100	0.17	Contact Map
2cwdA	1	0.966	100	0.177	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.