CSPC - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CSPC - Cold shock-like protein CspC

UniProt:	P0A9Y6	Sequences: MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKGPAAVNVTAI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12204
Length:	69 (63)
Sequences:	4119 (1631)
Seq/√Len:	205.5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_V	66_V	3.699	1.00
55_Q	64_V	3.472	1.00
53_E	65_N	2.677	1.00
51_E	67_T	2.308	1.00
13_E	45_A	2.257	1.00
7_Q	49_N	2.113	1.00
23_A	49_N	2.031	1.00
37_Q	67_T	1.960	1.00
4_I	22_P	1.951	1.00
5_K	51_E	1.929	1.00
22_P	27_K	1.695	1.00
5_K	49_N	1.644	1.00
45_A	48_Q	1.622	1.00
35_A	64_V	1.611	1.00
56_D	61_P	1.568	1.00
37_Q	65_N	1.482	1.00
31_V	44_L	1.466	1.00
57_G	62_A	1.437	1.00
13_E	41_F	1.424	1.00
22_P	52_F	1.314	1.00
13_E	43_T	1.310	1.00
57_G	61_P	1.229	1.00
22_P	25_G	1.212	1.00
29_V	54_I	1.197	1.00
36_I	41_F	1.123	1.00
27_K	61_P	1.104	1.00
36_I	42_K	1.103	1.00
54_I	61_P	1.080	1.00
44_L	50_V	1.047	1.00
7_Q	21_T	1.037	1.00
5_K	23_A	1.010	1.00
35_A	55_Q	0.996	1.00
20_I	52_F	0.987	1.00
33_F	42_K	0.981	1.00
57_G	60_G	0.976	1.00
6_G	20_I	0.972	1.00
9_K	28_D	0.956	0.99
9_K	15_K	0.906	0.99
20_I	50_V	0.889	0.99
6_G	63_A	0.868	0.99
11_F	33_F	0.861	0.99
4_I	24_D	0.854	0.99
36_I	39_N	0.832	0.99
10_W	15_K	0.828	0.99
35_A	65_N	0.825	0.98
33_F	36_I	0.769	0.98
55_Q	62_A	0.768	0.98
14_S	48_Q	0.760	0.97
11_F	15_K	0.742	0.97
20_I	63_A	0.741	0.97
52_F	63_A	0.725	0.97
33_F	59_K	0.694	0.96
36_I	66_V	0.667	0.95
4_I	52_F	0.659	0.94
38_G	42_K	0.652	0.94
12_N	30_F	0.651	0.94
22_P	54_I	0.639	0.93
7_Q	23_A	0.637	0.93
15_K	28_D	0.636	0.93
11_F	16_G	0.631	0.93
20_I	31_V	0.625	0.92
18_G	31_V	0.617	0.92
19_F	32_H	0.612	0.92
16_G	28_D	0.611	0.92
29_V	55_Q	0.611	0.92
29_V	35_A	0.599	0.91
10_W	31_V	0.595	0.90
21_T	47_G	0.585	0.90
4_I	67_T	0.582	0.89
9_K	16_G	0.580	0.89
14_S	62_A	0.578	0.89
58_Q	61_P	0.564	0.88
10_W	28_D	0.563	0.88
8_V	44_L	0.555	0.87
46_E	62_A	0.554	0.87
11_F	41_F	0.551	0.87
21_T	29_V	0.550	0.87
43_T	48_Q	0.546	0.86
4_I	13_E	0.546	0.86
29_V	63_A	0.544	0.86
4_I	54_I	0.541	0.86
38_G	41_F	0.528	0.84
34_S	59_K	0.525	0.84
27_K	56_D	0.524	0.84
30_F	48_Q	0.519	0.83
27_K	65_N	0.518	0.83
12_N	17_F	0.517	0.83
16_G	60_G	0.513	0.83
15_K	40_G	0.509	0.82
33_F	66_V	0.508	0.82
33_F	41_F	0.505	0.82
10_W	16_G	0.505	0.82
56_D	64_V	0.502	0.81
33_F	37_Q	0.500	0.81

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3i2zB	2	1	99.7	0.137	Contact Map
2lssA	1	1	99.7	0.175	Contact Map
3camA	2	0.971	99.7	0.177	Contact Map
2mqhA	1	0.971	99.7	0.187	Contact Map
1h95A	1	1	99.7	0.19	Contact Map
3uljA	3	1	99.7	0.191	Contact Map
1c9oA	2	0.9565	99.7	0.201	Contact Map
1g6pA	1	0.942	99.7	0.202	Contact Map
3ts2A	1	1	99.7	0.205	Contact Map
2lxjA	1	0.9565	99.6	0.208	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.