BTUR - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BTUR - Cob(I)yrinic acid a,c-diamide adenosyltransferase

UniProt:	P0A9H5	Sequences: MSDERYQQRQQRVKEKVDARVAQAQDERGIIIVFTGNGKGKTTAAFGTATRAVGHGKKVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWDTQNRESDTAACREVWQHAKRMLADSSLDMVLLDELTYMVAYDYLPLEEVVQALNERPHQQTVIITGRGCHRDILELADTVSELRPVKHAFDAGVKAQIGIDY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10130
Length:	196 (171)
Sequences:	2206 (1206)
Seq/√Len:	92.2

ECOLI - BTUR
HALSA - Q9HPL6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
129_L	158_I	3.669	1.00
179_P	185_D	3.604	1.00
165_R	169_E	3.040	1.00
173_T	183_A	2.976	1.00
49_A	125_L	2.910	1.00
148_N	170_L	2.900	1.00
147_L	156_V	2.631	1.00
140_L	166_D	2.629	1.00
60_G	115_M	2.599	1.00
106_R	142_E	2.363	1.00
113_K	142_E	2.311	1.00
85_Q	111_H	2.255	1.00
155_T	191_Q	2.222	1.00
42_T	46_F	2.195	1.00
48_T	157_I	2.179	1.00
45_A	125_L	2.119	1.00
55_H	72_G	2.051	1.00
129_L	143_V	2.024	1.00
50_T	76_L	1.973	1.00
53_V	82_V	1.949	1.00
140_L	164_H	1.891	1.00
35_T	163_C	1.884	1.00
33_V	167_I	1.790	1.00
111_H	114_R	1.760	1.00
30_I	183_A	1.716	1.00
145_Q	149_E	1.695	1.00
49_A	61_V	1.663	1.00
176_E	180_V	1.660	1.00
52_A	57_K	1.635	1.00
46_F	50_T	1.624	1.00
31_I	158_I	1.622	1.00
34_F	44_A	1.579	1.00
140_L	144_V	1.574	1.00
112_A	126_L	1.567	1.00
45_A	159_T	1.562	1.00
32_I	155_T	1.556	1.00
168_L	174_V	1.553	1.00
31_I	150_R	1.545	1.00
83_E	121_L	1.529	1.00
146_A	156_V	1.527	1.00
61_V	125_L	1.522	1.00
31_I	147_L	1.497	1.00
133_V	164_H	1.475	1.00
61_V	82_V	1.467	1.00
77_L	82_V	1.464	1.00
46_F	61_V	1.418	0.99
50_T	77_L	1.401	0.99
103_A	107_E	1.396	0.99
32_I	173_T	1.394	0.99
106_R	110_Q	1.392	0.99
37_N	179_P	1.377	0.99
121_L	124_V	1.377	0.99
99_E	103_A	1.374	0.99
49_A	82_V	1.370	0.99
134_A	162_G	1.369	0.99
49_A	59_V	1.364	0.99
174_V	181_K	1.326	0.99
74_R	78_E	1.323	0.99
83_E	115_M	1.316	0.99
144_V	170_L	1.280	0.99
32_I	191_Q	1.277	0.99
144_V	148_N	1.275	0.99
163_C	168_L	1.267	0.99
124_V	154_Q	1.245	0.98
116_L	146_A	1.238	0.98
110_Q	113_K	1.218	0.98
87_M	108_V	1.209	0.98
70_P	75_N	1.193	0.98
141_E	166_D	1.189	0.98
130_T	163_C	1.185	0.98
30_I	188_V	1.166	0.98
151_P	154_Q	1.162	0.98
60_G	121_L	1.136	0.97
57_K	122_D	1.097	0.97
62_V	112_A	1.083	0.96
118_D	121_L	1.083	0.96
32_I	183_A	1.076	0.96
53_V	76_L	1.065	0.96
65_I	131_Y	1.056	0.96
97_N	100_S	1.049	0.96
62_V	111_H	1.038	0.95
139_P	142_E	1.038	0.95
107_E	110_Q	1.025	0.95
117_A	149_E	1.024	0.95
133_V	138_L	1.019	0.95
29_G	150_R	0.996	0.94
58_K	120_S	0.995	0.94
102_T	106_R	0.992	0.94
145_Q	148_N	0.988	0.94
168_L	180_V	0.971	0.93
31_I	170_L	0.964	0.93
133_V	143_V	0.958	0.93
172_D	186_A	0.956	0.93
116_L	154_Q	0.955	0.93
95_T	98_R	0.950	0.93
88_A	108_V	0.949	0.93
141_E	145_Q	0.949	0.93
115_M	121_L	0.946	0.92
113_K	146_A	0.939	0.92
114_R	118_D	0.935	0.92
33_V	130_T	0.935	0.92
34_F	48_T	0.935	0.92
60_G	85_Q	0.923	0.92
122_D	153_Q	0.915	0.91
119_S	153_Q	0.914	0.91
110_Q	114_R	0.913	0.91
89_T	104_A	0.912	0.91
62_V	85_Q	0.912	0.91
52_A	122_D	0.864	0.89
133_V	140_L	0.852	0.88
113_K	145_Q	0.851	0.88
37_N	162_G	0.845	0.87
89_T	100_S	0.836	0.87
74_R	84_F	0.832	0.87
87_M	111_H	0.828	0.86
35_T	161_R	0.826	0.86
31_I	129_L	0.824	0.86
38_G	41_K	0.822	0.86
155_T	173_T	0.819	0.86
48_T	195_D	0.817	0.86
150_R	154_Q	0.813	0.85
123_M	157_I	0.807	0.85
183_A	188_V	0.802	0.85
116_L	124_V	0.799	0.84
88_A	105_C	0.798	0.84
43_T	63_Q	0.796	0.84
43_T	48_T	0.793	0.84
113_K	149_E	0.791	0.84
163_C	167_I	0.785	0.83
62_V	108_V	0.782	0.83
64_F	112_A	0.772	0.82
92_T	97_N	0.763	0.82
36_G	47_G	0.761	0.81
150_R	156_V	0.756	0.81
109_W	146_A	0.753	0.81
34_F	183_A	0.745	0.80
62_V	87_M	0.743	0.80
83_E	114_R	0.741	0.80
34_F	177_L	0.735	0.79
67_G	86_V	0.735	0.79
58_K	122_D	0.732	0.79
109_W	113_K	0.731	0.79
106_R	139_P	0.729	0.79
89_T	101_D	0.715	0.77
38_G	47_G	0.713	0.77
27_E	189_K	0.711	0.77
48_T	123_M	0.706	0.76
41_K	47_G	0.705	0.76
111_H	115_M	0.700	0.76
136_D	164_H	0.698	0.75
44_A	177_L	0.697	0.75
76_L	79_P	0.694	0.75
36_G	41_K	0.693	0.75
57_K	155_T	0.687	0.74
46_F	77_L	0.683	0.74
192_I	196_Y	0.673	0.73
92_T	137_Y	0.666	0.72
57_K	192_I	0.666	0.72
113_K	117_A	0.664	0.72
28_R	152_H	0.661	0.71
144_V	166_D	0.660	0.71
34_F	43_T	0.658	0.71
115_M	124_V	0.657	0.71
132_M	138_L	0.656	0.71
47_G	73_E	0.655	0.71
55_H	192_I	0.655	0.71
138_L	143_V	0.651	0.70
75_N	78_E	0.651	0.70
48_T	194_I	0.650	0.70
142_E	146_A	0.650	0.70
34_F	179_P	0.643	0.69
190_A	196_Y	0.641	0.69
58_K	83_E	0.640	0.69
109_W	112_A	0.636	0.69
34_F	191_Q	0.634	0.68
74_R	86_V	0.631	0.68
95_T	100_S	0.631	0.68
129_L	133_V	0.629	0.68
53_V	59_V	0.629	0.68
112_A	124_V	0.626	0.67
121_L	154_Q	0.618	0.66
116_L	156_V	0.618	0.66
104_A	107_E	0.615	0.66
61_V	84_F	0.613	0.66
28_R	188_V	0.612	0.66
136_D	139_P	0.608	0.65
119_S	154_Q	0.608	0.65
130_T	195_D	0.604	0.65
65_I	104_A	0.599	0.64
149_E	186_A	0.598	0.64
83_E	120_S	0.595	0.63
63_Q	74_R	0.594	0.63
94_D	195_D	0.592	0.63
171_A	174_V	0.591	0.63
183_A	191_Q	0.590	0.63
33_V	171_A	0.589	0.63
52_A	123_M	0.586	0.62
101_D	105_C	0.585	0.62
95_T	101_D	0.584	0.62
65_I	92_T	0.581	0.62
32_I	194_I	0.575	0.61
40_G	47_G	0.575	0.61
68_T	71_N	0.574	0.61
109_W	116_L	0.574	0.61
130_T	167_I	0.573	0.61
101_D	104_A	0.572	0.60
44_A	48_T	0.569	0.60
74_R	195_D	0.565	0.59
29_G	151_P	0.563	0.59
131_Y	135_Y	0.563	0.59
97_N	101_D	0.562	0.59
93_W	97_N	0.558	0.59
51_R	54_G	0.556	0.58
36_G	42_T	0.555	0.58
51_R	175_S	0.554	0.58
39_K	155_T	0.554	0.58
39_K	43_T	0.554	0.58
35_T	180_V	0.552	0.58
36_G	40_G	0.548	0.57
55_H	195_D	0.545	0.57
191_Q	194_I	0.543	0.56
163_C	174_V	0.542	0.56
93_W	96_Q	0.541	0.56
166_D	170_L	0.539	0.56
101_D	131_Y	0.538	0.56
88_A	101_D	0.537	0.56
60_G	111_H	0.536	0.55
139_P	144_V	0.535	0.55
30_I	150_R	0.534	0.55
34_F	173_T	0.533	0.55
190_A	195_D	0.531	0.55
99_E	102_T	0.530	0.55
68_T	192_I	0.530	0.55
120_S	149_E	0.530	0.55
98_R	101_D	0.529	0.55
168_L	181_K	0.529	0.55
174_V	180_V	0.526	0.54
146_A	149_E	0.523	0.54
85_Q	108_V	0.522	0.54
37_N	178_R	0.522	0.54
32_I	48_T	0.520	0.53
68_T	86_V	0.520	0.53
90_G	97_N	0.520	0.53
66_K	128_E	0.519	0.53
98_R	102_T	0.516	0.53
67_G	135_Y	0.514	0.52
189_K	196_Y	0.514	0.52
59_V	82_V	0.513	0.52
90_G	93_W	0.513	0.52
86_V	108_V	0.509	0.52
36_G	73_E	0.508	0.52
53_V	81_G	0.504	0.51
151_P	170_L	0.502	0.51
112_A	115_M	0.501	0.51
170_L	174_V	0.500	0.51
69_W	86_V	0.500	0.51

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1g5tA	2	0.801	100	0.412	Contact Map
2orvA	3	0.6531	99.9	0.631	Contact Map
2j9rA	3	0.6888	99.8	0.724	Contact Map
1w4rA	3	0.7143	99.7	0.742	Contact Map
1xx6A	4	0.7143	99.7	0.755	Contact Map
3e2iA	3	0.6786	99.7	0.756	Contact Map
2b8tA	3	0.75	99.5	0.789	Contact Map
4uxhA	3	0.699	98.9	0.834	Contact Map
2orwA	3	0.7041	98.8	0.841	Contact Map
4blqA	3	0.8214	97.1	0.895	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.