FUR - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FUR - Ferric uptake regulation protein

UniProt:	P0A9A9	Sequences: MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10359
Length:	148 (133)
Sequences:	7247 (4786)
Seq/√Len:	415.0

ECOLI - FUR ZUR
BACSU - PERR FUR ZUR
SULSO - Q97WH5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
94_L	123_T	3.945	1.00
95_D	132_H	3.553	1.00
98_K	135_E	3.065	1.00
121_R	137_D	3.064	1.00
26_L	68_V	2.726	1.00
122_L	129_L	2.186	1.00
25_V	42_R	2.177	1.00
119_G	134_A	2.140	1.00
94_L	130_Y	2.030	1.00
5_N	20_L	1.999	1.00
15_V	20_L	1.990	1.00
63_D	70_R	1.946	1.00
94_L	132_H	1.874	1.00
70_R	78_S	1.874	1.00
36_A	59_L	1.834	1.00
96_C	133_C	1.827	1.00
63_D	68_V	1.776	1.00
41_K	44_I	1.774	1.00
40_Y	52_L	1.771	1.00
29_P	42_R	1.770	1.00
29_P	32_H	1.731	1.00
13_L	65_A	1.721	1.00
60_N	70_R	1.667	1.00
6_T	10_K	1.665	1.00
22_I	58_V	1.603	1.00
123_T	132_H	1.602	1.00
89_D	125_H	1.570	1.00
91_L	100_I	1.562	1.00
113_E	117_K	1.528	1.00
93_C	96_C	1.509	1.00
96_C	136_G	1.508	1.00
24_E	28_E	1.442	1.00
40_Y	44_I	1.408	1.00
100_I	120_I	1.395	1.00
133_C	136_G	1.372	1.00
91_L	120_I	1.352	1.00
33_H	90_H	1.341	1.00
93_C	133_C	1.334	1.00
23_L	62_F	1.333	1.00
42_R	45_D	1.324	1.00
25_V	39_L	1.317	1.00
77_K	80_F	1.306	1.00
21_K	24_E	1.305	1.00
33_H	81_E	1.303	1.00
35_S	38_D	1.275	1.00
7_A	11_A	1.275	1.00
21_K	46_M	1.263	1.00
120_I	134_A	1.248	1.00
20_L	24_E	1.242	1.00
25_V	43_L	1.215	1.00
29_P	34_V	1.195	1.00
87_H	125_H	1.190	1.00
18_P	54_T	1.165	1.00
109_A	113_E	1.135	1.00
58_V	61_Q	1.135	1.00
83_T	86_H	1.134	1.00
121_R	132_H	1.089	1.00
40_Y	55_V	1.056	1.00
112_R	116_A	1.051	1.00
34_V	79_V	1.016	1.00
61_Q	65_A	1.005	1.00
25_V	29_P	1.004	1.00
92_I	130_Y	1.004	1.00
91_L	131_G	0.998	1.00
120_I	131_G	0.997	1.00
25_V	34_V	0.990	1.00
33_H	88_H	0.988	1.00
134_A	138_C	0.987	1.00
32_H	42_R	0.975	1.00
34_V	42_R	0.968	1.00
62_F	67_I	0.959	1.00
19_R	61_Q	0.954	1.00
88_H	101_E	0.953	1.00
132_H	137_D	0.951	1.00
25_V	46_M	0.951	1.00
33_H	101_E	0.943	1.00
7_A	10_K	0.942	1.00
92_I	128_Y	0.933	1.00
92_I	97_G	0.930	1.00
100_I	118_H	0.929	1.00
13_L	61_Q	0.922	1.00
18_P	50_I	0.920	1.00
104_D	107_I	0.905	1.00
124_N	130_Y	0.902	1.00
5_N	9_K	0.899	1.00
106_S	109_A	0.891	1.00
37_E	41_K	0.882	1.00
104_D	110_R	0.877	1.00
36_A	55_V	0.870	1.00
41_K	45_D	0.870	1.00
119_G	137_D	0.868	1.00
34_V	39_L	0.865	1.00
17_L	21_K	0.863	1.00
93_C	136_G	0.857	1.00
60_N	63_D	0.853	1.00
89_D	102_F	0.847	1.00
43_L	50_I	0.838	1.00
23_L	67_I	0.832	1.00
21_K	47_G	0.830	1.00
97_G	100_I	0.821	1.00
22_I	39_L	0.819	1.00
26_L	34_V	0.813	1.00
43_L	47_G	0.812	1.00
91_L	118_H	0.808	1.00
71_H	101_E	0.805	1.00
89_D	111_Q	0.803	1.00
105_D	125_H	0.800	1.00
94_L	124_N	0.799	1.00
33_H	99_V	0.796	1.00
32_H	38_D	0.791	1.00
24_E	46_M	0.787	1.00
19_R	58_V	0.785	1.00
89_D	105_D	0.785	1.00
44_I	52_L	0.785	1.00
111_Q	125_H	0.776	1.00
28_E	42_R	0.775	1.00
60_N	64_D	0.771	1.00
115_A	122_L	0.768	1.00
17_L	20_L	0.756	1.00
79_V	82_L	0.733	1.00
28_E	46_M	0.732	1.00
36_A	52_L	0.724	1.00
67_I	82_L	0.718	1.00
38_D	41_K	0.717	1.00
125_H	129_L	0.716	1.00
37_E	52_L	0.712	1.00
75_G	79_V	0.711	1.00
9_K	15_V	0.709	1.00
125_H	130_Y	0.707	1.00
18_P	51_G	0.706	1.00
54_T	58_V	0.704	1.00
135_E	138_C	0.691	1.00
107_I	111_Q	0.691	1.00
18_P	58_V	0.690	1.00
113_E	116_A	0.683	1.00
59_L	63_D	0.682	1.00
92_I	99_V	0.668	0.99
90_H	101_E	0.666	0.99
71_H	128_Y	0.666	0.99
103_S	106_S	0.665	0.99
107_I	110_R	0.656	0.99
33_H	51_G	0.652	0.99
33_H	37_E	0.649	0.99
27_Q	82_L	0.647	0.99
126_S	130_Y	0.647	0.99
22_I	25_V	0.643	0.99
40_Y	50_I	0.643	0.99
8_L	23_L	0.636	0.99
37_E	40_Y	0.629	0.99
59_L	68_V	0.624	0.99
89_D	127_L	0.612	0.99
23_L	27_Q	0.607	0.99
78_S	82_L	0.605	0.99
38_D	42_R	0.604	0.99
37_E	77_K	0.602	0.99
69_T	126_S	0.600	0.99
8_L	61_Q	0.597	0.99
21_K	43_L	0.594	0.99
39_L	68_V	0.590	0.99
39_L	55_V	0.584	0.99
16_T	20_L	0.583	0.99
123_T	131_G	0.583	0.99
105_D	129_L	0.582	0.99
26_L	39_L	0.581	0.99
132_H	136_G	0.581	0.99
81_E	84_Q	0.580	0.99
73_F	126_S	0.579	0.99
69_T	83_T	0.578	0.99
89_D	129_L	0.578	0.99
111_Q	114_I	0.576	0.98
16_T	54_T	0.571	0.98
6_T	9_K	0.569	0.98
109_A	112_R	0.567	0.98
72_N	76_G	0.558	0.98
26_L	35_S	0.557	0.98
93_C	120_I	0.554	0.98
5_N	15_V	0.553	0.98
8_L	13_L	0.553	0.98
15_V	23_L	0.553	0.98
104_D	109_A	0.548	0.98
35_S	79_V	0.545	0.98
89_D	107_I	0.542	0.98
134_A	137_D	0.542	0.98
54_T	57_R	0.539	0.98
87_H	108_E	0.535	0.98
22_I	62_F	0.531	0.97
100_I	135_E	0.530	0.97
13_L	19_R	0.530	0.97
26_L	82_L	0.528	0.97
21_K	25_V	0.528	0.97
21_K	50_I	0.526	0.97
103_S	117_K	0.526	0.97
87_H	105_D	0.525	0.97
30_D	83_T	0.520	0.97
25_V	28_E	0.517	0.97
120_I	137_D	0.516	0.97
39_L	42_R	0.511	0.97
62_F	68_V	0.503	0.96
16_T	53_A	0.503	0.96
52_L	57_R	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2xigA	4	0.9459	100	0.128	Contact Map
2fe3A	2	0.9459	100	0.129	Contact Map
4mtdA	2	0.9527	100	0.139	Contact Map
4etsA	2	0.9527	100	0.141	Contact Map
3eyyA	2	0.8986	100	0.147	Contact Map
2w57A	2	0.8851	100	0.158	Contact Map
3mwmA	2	0.8514	100	0.164	Contact Map
2o03A	2	0.8716	100	0.19	Contact Map
1mzbA	4	0.8919	100	0.198	Contact Map
4lmyA	2	0.973	100	0.198	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.