RIMJ - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RIMJ - Ribosomal-protein-alanine acetyltransferase

UniProt:	P0A948	Sequences: MFGYRSNVPKVRLTTDRLVVRLVHDRDAWRLADYYAENRHFLKPWEPVRDESHCYPSGWQARLGMINEFHKQGSAFYFGLFDPDEKEIIGVANFSNVVRGSFHACYLGYSIGQKWQGKGLMFEALTAAIRYMQRTQHIHRIMANYMPHNKRSGDLLARLGFEKEGYAKDYLLIDGQWRDHVLTALTTPDWTPGR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10851
Length:	194 (170)
Sequences:	19802 (15182)
Seq/√Len:	1164.4

ECOLI - RIMJ ATDA RIML YHHY MNAT
BACSU - YJCK YDAF YOKL YOAA YNAD YKKB YJDG YWNH
HALSA - Q9HMZ2 Q9HRY6 Q9HNJ3 Q9HRY5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
122_F	158_R	2.704	1.00
143_A	156_L	2.617	1.00
21_R	81_F	2.594	1.00
82_D	85_E	2.497	1.00
21_R	27_D	2.298	1.00
14_T	83_P	2.222	1.00
164_E	184_A	2.184	1.00
17_R	123_E	2.144	1.00
163_K	181_V	2.109	1.00
163_K	166_Y	2.102	1.00
105_C	138_I	2.058	1.00
145_Y	153_G	2.047	1.00
94_F	132_M	2.046	1.00
15_T	127_A	2.004	1.00
39_R	113_Q	1.960	1.00
145_Y	156_L	1.910	1.00
153_G	157_A	1.905	1.00
15_T	123_E	1.883	1.00
154_D	157_A	1.865	1.00
130_R	134_R	1.824	1.00
107_L	125_L	1.817	1.00
79_G	88_I	1.788	1.00
129_I	161_F	1.758	1.00
23_V	79_G	1.693	1.00
29_W	56_P	1.687	1.00
166_Y	181_V	1.674	1.00
19_V	83_P	1.639	1.00
37_E	113_Q	1.626	1.00
129_I	141_I	1.615	1.00
28_A	60_Q	1.610	1.00
153_G	181_V	1.604	1.00
112_G	115_W	1.595	1.00
30_R	88_I	1.588	1.00
139_H	169_D	1.578	1.00
92_A	124_A	1.566	1.00
127_A	130_R	1.529	1.00
125_L	159_L	1.529	1.00
147_P	179_D	1.526	1.00
172_L	177_W	1.526	1.00
81_F	86_K	1.526	1.00
153_G	163_K	1.521	1.00
55_Y	58_G	1.509	1.00
56_P	60_Q	1.482	1.00
111_I	121_M	1.472	1.00
62_R	66_I	1.433	1.00
25_D	64_G	1.384	1.00
157_A	163_K	1.379	1.00
150_K	153_G	1.374	1.00
80_L	111_I	1.347	1.00
80_L	124_A	1.345	1.00
14_T	19_V	1.343	1.00
82_D	89_I	1.322	1.00
13_L	127_A	1.311	1.00
140_R	184_A	1.295	1.00
153_G	183_T	1.284	1.00
122_F	155_L	1.282	1.00
92_A	128_A	1.270	1.00
19_V	81_F	1.249	1.00
139_H	177_W	1.245	1.00
89_I	115_W	1.243	1.00
131_Y	135_T	1.241	1.00
30_R	87_E	1.221	1.00
109_Y	156_L	1.217	1.00
170_Y	180_H	1.210	1.00
147_P	166_Y	1.206	1.00
148_H	178_R	1.197	1.00
167_A	182_L	1.191	1.00
87_E	115_W	1.172	1.00
82_D	120_L	1.170	1.00
32_A	56_P	1.143	1.00
68_E	72_Q	1.134	1.00
28_A	63_L	1.130	1.00
87_E	114_K	1.130	1.00
132_M	141_I	1.116	1.00
121_M	155_L	1.088	1.00
60_Q	64_G	1.080	1.00
91_V	110_S	1.076	1.00
116_Q	151_R	1.068	1.00
106_Y	144_N	1.068	1.00
109_Y	152_S	1.064	1.00
132_M	136_Q	1.058	1.00
34_Y	112_G	1.051	1.00
131_Y	136_Q	1.049	1.00
15_T	18_L	1.043	1.00
145_Y	183_T	1.038	1.00
25_D	60_Q	1.035	1.00
34_Y	110_S	1.026	1.00
13_L	131_Y	1.021	1.00
113_Q	116_Q	1.021	1.00
28_A	56_P	1.019	1.00
13_L	20_V	1.007	1.00
78_F	128_A	1.004	1.00
163_K	183_T	1.004	1.00
12_R	19_V	0.999	1.00
98_V	102_F	0.995	1.00
122_F	126_T	0.993	1.00
30_R	33_D	0.988	1.00
169_D	179_D	0.986	1.00
139_H	187_T	0.985	1.00
104_A	142_M	0.974	1.00
78_F	131_Y	0.968	1.00
166_Y	179_D	0.966	1.00
32_A	36_A	0.961	1.00
82_D	87_E	0.960	1.00
140_R	164_E	0.959	1.00
129_I	185_L	0.958	1.00
82_D	118_K	0.946	1.00
143_A	161_F	0.942	1.00
155_L	159_L	0.939	1.00
37_E	114_K	0.936	1.00
81_F	88_I	0.933	1.00
37_E	112_G	0.932	1.00
147_P	181_V	0.909	1.00
150_K	154_D	0.908	1.00
19_V	86_K	0.908	1.00
117_G	151_R	0.905	1.00
61_A	65_M	0.896	1.00
126_T	130_R	0.892	1.00
156_L	161_F	0.892	1.00
146_M	178_R	0.890	1.00
23_V	91_V	0.890	1.00
129_I	159_L	0.889	1.00
25_D	67_N	0.887	1.00
168_K	184_A	0.883	1.00
69_F	74_S	0.882	1.00
94_F	128_A	0.875	1.00
33_D	112_G	0.874	1.00
27_D	81_F	0.873	1.00
168_K	179_D	0.872	1.00
87_E	112_G	0.870	1.00
122_F	159_L	0.863	1.00
32_A	59_W	0.855	1.00
161_F	185_L	0.854	1.00
18_L	120_L	0.852	1.00
132_M	138_I	0.841	1.00
126_T	159_L	0.827	1.00
104_A	140_R	0.825	1.00
123_E	127_A	0.824	1.00
115_W	118_K	0.818	1.00
18_L	124_A	0.818	1.00
137_H	187_T	0.817	1.00
25_D	28_A	0.815	1.00
111_I	120_L	0.813	1.00
103_H	172_L	0.797	1.00
104_A	170_Y	0.796	1.00
28_A	32_A	0.795	1.00
103_H	177_W	0.784	1.00
109_Y	121_M	0.776	1.00
82_D	115_W	0.775	1.00
152_S	156_L	0.774	1.00
35_Y	110_S	0.771	1.00
45_W	146_M	0.771	1.00
69_F	75_A	0.765	1.00
42_L	116_Q	0.764	1.00
30_R	112_G	0.761	1.00
172_L	176_Q	0.757	1.00
33_D	37_E	0.750	1.00
39_R	44_P	0.743	1.00
144_N	167_A	0.741	1.00
29_W	33_D	0.741	1.00
57_S	60_Q	0.740	1.00
168_K	186_T	0.733	1.00
80_L	92_A	0.730	1.00
33_D	87_E	0.730	1.00
140_R	186_T	0.730	1.00
117_G	122_F	0.728	1.00
150_K	157_A	0.720	1.00
61_A	64_G	0.720	1.00
45_W	148_H	0.719	1.00
58_G	61_A	0.717	1.00
144_N	180_H	0.716	1.00
106_Y	142_M	0.714	1.00
15_T	20_V	0.713	1.00
33_D	114_K	0.712	1.00
167_A	170_Y	0.707	1.00
77_Y	93_N	0.707	1.00
21_R	79_G	0.701	1.00
17_R	119_G	0.697	1.00
164_E	168_K	0.693	1.00
22_L	70_H	0.687	1.00
157_A	183_T	0.685	1.00
80_L	120_L	0.685	1.00
145_Y	181_V	0.676	1.00
117_G	154_D	0.671	1.00
16_D	123_E	0.666	1.00
43_K	50_D	0.663	1.00
146_M	173_I	0.662	1.00
145_Y	152_S	0.654	1.00
169_D	177_W	0.654	1.00
125_L	155_L	0.648	1.00
48_V	51_E	0.646	1.00
59_W	63_L	0.638	1.00
57_S	61_A	0.637	1.00
43_K	46_E	0.636	1.00
151_R	154_D	0.634	1.00
154_D	158_R	0.634	1.00
105_C	132_M	0.634	1.00
64_G	68_E	0.631	1.00
122_F	151_R	0.630	1.00
37_E	116_Q	0.622	1.00
59_W	62_R	0.620	1.00
148_H	176_Q	0.619	1.00
109_Y	125_L	0.619	1.00
42_L	110_S	0.618	1.00
103_H	139_H	0.610	1.00
39_R	116_Q	0.610	1.00
143_A	152_S	0.609	1.00
109_Y	155_L	0.608	1.00
80_L	90_G	0.603	1.00
89_I	120_L	0.599	1.00
92_A	125_L	0.599	1.00
66_I	77_Y	0.598	1.00
94_F	105_C	0.594	1.00
147_P	153_G	0.594	1.00
88_I	91_V	0.590	1.00
169_D	186_T	0.585	1.00
22_L	67_N	0.581	1.00
21_R	24_H	0.580	1.00
171_L	180_H	0.580	1.00
18_L	123_E	0.578	1.00
34_Y	88_I	0.567	1.00
46_E	49_R	0.564	1.00
46_E	110_S	0.561	1.00
111_I	115_W	0.560	1.00
24_H	27_D	0.556	1.00
172_L	175_G	0.556	1.00
142_M	170_Y	0.555	1.00
159_L	185_L	0.553	1.00
111_I	116_Q	0.552	1.00
103_H	137_H	0.551	1.00
144_N	182_L	0.549	1.00
142_M	167_A	0.548	1.00
162_E	168_K	0.546	1.00
51_E	59_W	0.542	1.00
107_L	141_I	0.540	1.00
80_L	121_M	0.539	1.00
95_S	106_Y	0.538	1.00
140_R	170_Y	0.530	1.00
169_D	187_T	0.529	1.00
96_N	105_C	0.527	1.00
120_L	123_E	0.524	1.00
167_A	184_A	0.522	1.00
105_C	141_I	0.522	1.00
70_H	76_F	0.522	1.00
129_I	133_Q	0.520	1.00
173_I	176_Q	0.519	1.00
30_R	81_F	0.518	1.00
117_G	155_L	0.514	1.00
97_V	105_C	0.509	1.00
155_L	158_R	0.506	1.00
130_R	135_T	0.506	1.00
65_M	69_F	0.505	1.00
93_N	108_G	0.503	1.00
156_L	183_T	0.500	1.00
75_A	93_N	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3pzjA	2	0.9433	100	0.31	Contact Map
2vzyA	3	0.8711	100	0.322	Contact Map
1yreA	2	0.9124	100	0.331	Contact Map
1nslA	3	0.9227	100	0.331	Contact Map
2z10A	2	0.9227	100	0.341	Contact Map
2fckA	2	0.8918	100	0.341	Contact Map
3r9fA	1	0.9278	100	0.342	Contact Map
3igrA	2	0.9433	100	0.345	Contact Map
3tcvA	2	0.9588	100	0.366	Contact Map
1s7kA	2	0.8144	100	0.368	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.