ENTH - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ENTH - Proofreading thioesterase EntH

UniProt:	P0A8Y8	Sequences: MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTRTHQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQPLHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11105
Length:	137 (120)
Sequences:	3440 (2290)
Seq/√Len:	209.1

ECOLI - ENTH MENI YIGI PAAI
BACSU - COMA2
HALSA - Y1336
SULSO - Q97VK2 Y2140 Q97UX9 Y1253

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_E	97_K	3.332	1.00
83_T	111_N	2.503	1.00
30_R	37_E	2.413	1.00
38_A	65_L	2.411	1.00
29_T	39_E	2.410	1.00
27_V	39_E	2.393	1.00
101_V	119_F	2.245	1.00
91_R	124_R	2.234	1.00
30_R	35_V	2.217	1.00
65_L	100_G	2.183	1.00
117_V	125_R	2.035	1.00
120_D	124_R	2.020	1.00
37_E	101_V	2.008	1.00
40_M	57_A	1.961	1.00
35_V	101_V	1.942	1.00
106_H	111_N	1.939	1.00
62_A	129_C	1.937	1.00
66_G	131_L	1.928	1.00
32_G	35_V	1.875	1.00
104_P	107_L	1.855	1.00
39_E	99_R	1.811	1.00
59_A	85_L	1.789	1.00
35_V	103_Q	1.756	1.00
20_M	57_A	1.708	1.00
70_G	133_T	1.700	1.00
66_G	116_I	1.693	1.00
20_M	60_A	1.583	1.00
62_A	116_I	1.576	1.00
59_A	87_A	1.567	1.00
70_G	112_Q	1.563	1.00
84_E	88_T	1.504	1.00
74_T	77_G	1.456	1.00
52_L	81_V	1.422	1.00
37_E	99_R	1.414	1.00
117_V	128_T	1.413	1.00
44_T	47_H	1.379	1.00
87_A	127_C	1.375	1.00
103_Q	117_V	1.369	1.00
103_Q	115_E	1.286	1.00
58_S	127_C	1.251	1.00
105_L	128_T	1.244	1.00
75_R	78_Q	1.227	1.00
58_S	126_C	1.226	1.00
93_V	126_C	1.214	1.00
115_E	128_T	1.210	1.00
41_P	97_K	1.209	1.00
119_F	123_G	1.194	1.00
58_S	118_V	1.146	1.00
43_D	46_T	1.137	1.00
112_Q	135_V	1.129	1.00
26_I	38_A	1.116	1.00
50_F	71_F	1.105	1.00
69_A	114_W	1.101	1.00
88_T	113_S	1.093	1.00
29_T	37_E	1.077	1.00
34_D	72_M	1.061	1.00
17_D	22_A	1.032	1.00
105_L	115_E	1.031	1.00
28_Y	38_A	1.025	1.00
25_G	45_R	1.020	1.00
56_G	60_A	1.006	1.00
42_V	53_L	1.004	1.00
23_H	45_R	1.003	1.00
90_H	113_S	0.988	1.00
63_E	82_G	0.962	1.00
21_V	64_T	0.958	1.00
97_K	121_E	0.947	0.99
71_F	80_V	0.946	0.99
53_L	98_V	0.933	0.99
58_S	89_H	0.928	0.99
86_N	130_R	0.926	0.99
90_H	106_H	0.921	0.99
61_L	100_G	0.912	0.99
90_H	125_R	0.911	0.99
100_G	116_I	0.905	0.99
62_A	118_V	0.891	0.99
24_L	60_A	0.889	0.99
99_R	119_F	0.885	0.99
47_H	95_E	0.856	0.99
106_H	113_S	0.854	0.99
52_L	92_P	0.853	0.99
27_V	97_K	0.842	0.99
90_H	128_T	0.836	0.99
69_A	102_C	0.835	0.99
34_D	104_P	0.816	0.98
99_R	121_E	0.813	0.98
84_E	130_R	0.812	0.98
88_T	132_G	0.810	0.98
80_V	135_V	0.809	0.98
31_L	72_M	0.809	0.98
87_A	129_C	0.807	0.98
101_V	123_G	0.804	0.98
85_L	89_H	0.802	0.98
59_A	89_H	0.799	0.98
40_M	61_L	0.798	0.98
116_I	131_L	0.796	0.98
104_P	114_W	0.793	0.98
70_G	80_V	0.783	0.98
55_G	89_H	0.770	0.98
71_F	79_C	0.770	0.98
91_R	106_H	0.764	0.98
93_V	98_V	0.710	0.96
40_M	53_L	0.710	0.96
115_E	130_R	0.706	0.96
119_F	125_R	0.705	0.96
73_M	107_L	0.702	0.96
53_L	58_S	0.693	0.96
63_E	67_S	0.690	0.96
98_V	126_C	0.690	0.96
16_S	22_A	0.688	0.96
111_N	134_A	0.684	0.95
26_I	40_M	0.679	0.95
28_Y	68_M	0.679	0.95
26_I	60_A	0.678	0.95
46_T	57_A	0.674	0.95
19_T	22_A	0.672	0.95
99_R	120_D	0.669	0.95
49_P	67_S	0.669	0.95
91_R	120_D	0.668	0.95
112_Q	133_T	0.665	0.95
33_D	73_M	0.664	0.95
42_V	98_V	0.661	0.95
52_L	94_S	0.660	0.94
113_S	132_G	0.652	0.94
81_V	134_A	0.650	0.94
41_P	46_T	0.646	0.94
78_Q	135_V	0.642	0.94
36_L	72_M	0.637	0.93
46_T	53_L	0.637	0.93
102_C	114_W	0.635	0.93
19_T	46_T	0.634	0.93
101_V	117_V	0.623	0.93
100_G	118_V	0.622	0.93
28_Y	31_L	0.617	0.92
59_A	129_C	0.609	0.92
47_H	94_S	0.608	0.92
73_M	78_Q	0.605	0.91
26_I	61_L	0.604	0.91
83_T	134_A	0.600	0.91
69_A	104_P	0.598	0.91
83_T	132_G	0.595	0.91
83_T	88_T	0.586	0.90
36_L	69_A	0.585	0.90
70_G	114_W	0.576	0.89
110_Q	134_A	0.573	0.89
33_D	107_L	0.571	0.89
99_R	123_G	0.571	0.89
113_S	130_R	0.570	0.89
58_S	63_E	0.570	0.89
29_T	38_A	0.563	0.88
67_S	82_G	0.562	0.88
58_S	93_V	0.562	0.88
74_T	80_V	0.562	0.88
19_T	23_H	0.560	0.88
59_A	131_L	0.555	0.88
20_M	23_H	0.553	0.87
105_L	125_R	0.552	0.87
62_A	87_A	0.552	0.87
50_F	79_C	0.551	0.87
29_T	97_K	0.550	0.87
25_G	43_D	0.543	0.86
48_Q	67_S	0.539	0.86
27_V	41_P	0.539	0.86
88_T	130_R	0.539	0.86
93_V	120_D	0.534	0.86
66_G	133_T	0.533	0.85
31_L	68_M	0.532	0.85
73_M	77_G	0.529	0.85
114_W	133_T	0.525	0.85
18_N	22_A	0.519	0.84
65_L	116_I	0.519	0.84
34_D	107_L	0.518	0.84
42_V	46_T	0.516	0.84
48_Q	52_L	0.515	0.83
48_Q	66_G	0.513	0.83
103_Q	119_F	0.513	0.83
105_L	117_V	0.512	0.83
82_G	85_L	0.509	0.83
33_D	72_M	0.501	0.82
65_L	102_C	0.500	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vh5A	2	1	100	0.327	Contact Map
4k4cA	2	1	100	0.327	Contact Map
4qd8A	3	1	100	0.338	Contact Map
3lmbA	2	0.9854	100	0.339	Contact Map
4rmmA	2	0.9562	99.9	0.353	Contact Map
1sc0A	1	0.9927	99.9	0.363	Contact Map
3e8pA	3	0.9927	99.9	0.365	Contact Map
3gekA	3	0.8759	99.9	0.368	Contact Map
1yocA	4	0.9854	99.9	0.368	Contact Map
1t82A	2	0.9489	99.9	0.371	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.